KEGG   Chlamydia trachomatis F/SW5: FSW5_2961Help
Entry
FSW5_2961         CDS       T02166                                 

Gene name
sodM
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cfw  Chlamydia trachomatis F/SW5
Brite
Enzymes [BR:cfw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FSW5_2961 (sodM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Imm3
Motif
Other DBs
NCBI-ProteinID: CCE14347
LinkDB All DBs
Position
complement(328055..328675)
Genome map
AA seq 206 aa AA seqDB search
MVFSSYMLPALPYDYDALEPVISAEIMQLHHQKHHQGYINNLNEALKSLDVANATQDLTR
LIAINPALRFNGGSHINHSLFWEMLAPQGKGGGVPPRHELLKLIEKFWGSFDNFLKNFIT
SSAAVQGSGWGWLAFCPQKQELMVQTTANQDPLEATTGMIPLLGVDVWEHAYYLQYKNAR
MGYLQSFPSIINWDYIENRFVEMSKQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtcttttcttcttatatgcttcccgcattgccttatgattacgatgctttagagcct
gtaattagtgctgagattatgcaactgcatcatcaaaagcatcaccaaggatatataaat
aatttgaatgaggccttaaaaagtttagatgtagcaaacgctactcaagatttaacaagg
ttaatcgcaatcaatcctgctctgcgtttcaatggtggaagccatattaaccactctctt
ttctgggagatgcttgcgcctcaagggaaaggagggggagttcctcctcgtcatgaattg
ttaaaattaatcgaaaaattctggggctctttcgataactttttaaaaaattttattact
tcctctgctgcggtgcaaggatctggctggggatggttagctttttgtccccaaaaacaa
gagcttatggtacagactacagcaaaccaggatcctctggaggcgacgactgggatgatc
cctctcctaggagtagatgtgtgggagcacgcatattatctccagtataaaaatgcgaga
atgggctatctacaaagtttccccagcataattaattgggattatatagagaatcgcttt
gtagaaatgagcaagcaataa

DBGET integrated database retrieval system