KEGG   Campylobacter fetus subsp. venerealis 97/608: CFV97608_1090Help
Entry
CFV97608_1090     CDS       T03351                                 

Gene name
rplS
Definition
(GenBank) 50S ribosomal protein L19
  KO
K02884  large subunit ribosomal protein L19
Organism
cfx  Campylobacter fetus subsp. venerealis 97/608
Pathway
cfx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cfx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CFV97608_1090 (rplS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cfx03011]
    CFV97608_1090 (rplS)
Ribosome [BR:cfx03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CFV97608_1090 (rplS)
  Bacteria
    CFV97608_1090 (rplS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L19 ParD_antitoxin
Motif
Other DBs
NCBI-ProteinID: AIR80712
LinkDB All DBs
Position
complement(1085826..1086182)
Genome map
AA seq 118 aa AA seqDB search
MRNKYIEAFENAQIENKSVPDFRAGDTLRIAIRIKEGDKTRVQNFEGICIARRGSGSGET
FIIRKIGANSVGVERIFPIYSESLESITVLRRGRIRRSKLFYLRDRRGKAARIKELKK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacaaatacatagaagcatttgaaaatgctcaaattgaaaacaagtctgtgcct
gattttcgtgctggcgatactttaagaattgctattcgtatcaaagaaggcgataaaact
agagttcagaattttgaaggtatctgtatagctagacgcggtagcggttctggggagact
tttatcatcagaaaaataggtgcaaatagtgttggagttgagagaattttccctatttat
agcgaaagtttagagagtattacggttcttagaagaggacgtataagaagatctaagcta
ttttatctaagagatagacgcggtaaagctgcaagaattaaagaacttaaaaaataa

DBGET integrated database retrieval system