KEGG   Campylobacter fetus subsp. venerealis 97/608: CFV97608_1112Help
Entry
CFV97608_1112     CDS       T03351                                 

Gene name
katA
Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
cfx  Campylobacter fetus subsp. venerealis 97/608
Pathway
cfx00630  Glyoxylate and dicarboxylate metabolism
cfx01100  Metabolic pathways
cfx01110  Biosynthesis of secondary metabolites
cfx01130  Biosynthesis of antibiotics
cfx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CFV97608_1112 (katA)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CFV97608_1112 (katA)
Enzymes [BR:cfx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     CFV97608_1112 (katA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AIR80733
LinkDB All DBs
Position
complement(1105272..1106714)
Genome map
AA seq 480 aa AA seqDB search
MAKLLNTASGNPIADNQNSLTAGVRGPVLLQDYQLLEKLAFQNRERIPERTVHANGSGAY
GELEITEDISKYTKASLFQKGEKTKLFLRFSTVAGEAGAADAERDVRGFAIKFYTKEGNW
DLVGNNTPTFFLRDGFKFPDFIHTQKRDPKTHLRSNSAAWDFWSLNPETLHQVTILMSDR
GIPASYRHMHGFGSHTYSLINAKGERFWVKFHFKTRQGIKNLTNAEAGAIVAKDRESHQR
DLYNSIDKGDFPKWDFKIQIMTEEEANNCKFNPFDLTKIWPHAEYPLIPVGVMTLNKNPE
NYFNEVEQAAFSPSNIVPGISYSPDRMLQARIFSYPDAQRYRIGVHYQQLDVNKPIVNVN
NYYVGGSMNNGSYKQEPHAYYEPNSFGGPAENKDYLEPDLAISNAAQRFDHRVDTDYYSN
AAALFAILPADEKERLYSNIAESMDGVEDFIIERALGHFEKINPAYAAGVKAALSSKKSC
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttattaaacacagctagcggcaatccaatcgctgataatcaaaatagttta
acagcgggcgtaagaggtcctgttttattacaagattatcaattacttgaaaaacttgca
tttcaaaacagagagagaatccctgaaagaacagtacatgcaaacggtagcggagcttat
ggagagttagaaatcactgaagatatcagcaaatatactaaagcttcacttttccaaaaa
ggtgaaaaaacaaaactatttttaagattttcaacagttgcaggcgaagccggtgctgct
gatgctgagagagacgttcgtggttttgctatcaaattttatacaaaagagggtaactgg
gatttagtgggtaataatactcctacattctttttaagagacggttttaaatttccagat
tttatccatactcaaaaaagagatccaaaaactcatttaagatcaaatagcgcagcctgg
gatttttggtcattaaatcctgaaacacttcatcaagtaactatacttatgagcgatcgc
ggaattcctgcaagctaccgccatatgcatggttttggaagccatacttatagccttata
aatgcaaaaggtgaaagattttgggttaaattccactttaaaacaagacaaggaattaaa
aatcttacaaacgcagaagctggtgctatagtggcaaaagacagagagagccatcaaaga
gatctatataatagtatcgataaaggtgattttccaaaatgggatttcaaaatacaaatt
atgactgaagaagaagctaataactgtaaatttaatccattcgatttaacaaaaatttgg
cctcatgcagagtatccgctaatcccggttggcgtaatgactttaaataaaaatcctgaa
aattatttcaacgaagtagagcaagccgcatttagcccaagtaacatagttcctggcatt
agctacagcccagatcgtatgcttcaagctagaattttcagctatccagatgctcaaaga
tatagaataggcgtacattatcaacaactagacgtaaataaaccgatagtaaacgtaaat
aattattatgtaggtggatctatgaataacggtagctataaacaagagccgcacgcttat
tatgagccaaatagttttggcggtcctgctgaaaacaaagattatcttgagcctgatctt
gctatatcaaatgcagctcaaagatttgatcatagagtagatacagattattatagtaat
gcagcagctttatttgcgatacttccggctgatgaaaaagagagactttattcaaatatc
gctgagagtatggatggagtcgaggatttcatcatagaaagagcgcttggtcactttgaa
aaaattaatccggcttacgcagcaggagtaaaagcggcactttcttctaagaaaagttgt
taa

DBGET integrated database retrieval system