KEGG   Campylobacter fetus subsp. venerealis 84-112: CSG_3940Help
Entry
CSG_3940          CDS       T03740                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cfz  Campylobacter fetus subsp. venerealis 84-112
Pathway
cfz00061  Fatty acid biosynthesis
cfz00780  Biotin metabolism
cfz01100  Metabolic pathways
cfz01212  Fatty acid metabolism
Module
cfz_M00083  Fatty acid biosynthesis, elongation
cfz_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cfz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CSG_3940
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CSG_3940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cfz01004]
    CSG_3940
Enzymes [BR:cfz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CSG_3940
Lipid biosynthesis proteins [BR:cfz01004]
 Fatty acid synthase
  Component type
   CSG_3940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT 4HBT_2 MaoC_dehydratas AveC_like
Motif
Other DBs
NCBI-ProteinID: CDF64314
LinkDB All DBs
Position
379719..380165
Genome map
AA seq 148 aa AA seqDB search
MIDVVEIQKILPHRYPFLLIDRVCELETGKSVYAYKNITIAEQIFEGHFPGHPIYPGVMI
IEGMAQAGGILAFKSAEDPSGLSIENKVVYFMSIDRAKFRNPVKPGDKLEYRLEVLKHKG
NVWVLDGKAYVDDKLVAEAELKAMIVDK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgatagacgtagtagaaattcaaaaaattttaccacataggtatccgtttttgttaata
gacagagtttgtgaattagaaacgggtaaaagtgtttatgcgtataaaaatataactatc
gcagaacaaatttttgaaggacattttcctgggcatccgatatatccaggtgttatgata
atagaaggaatggctcaagcaggtggtattttggcatttaaaagtgcagaagatccaagc
ggtttgagcatagaaaataaagtcgtatattttatgagtatcgatagagctaaatttaga
aatcctgtaaagccaggagataagttagagtatcgtttagaggtattaaaacataaagga
aatgtttgggttttagacgggaaagcttacgtggacgataaattggtagctgaggctgag
ctaaaagctatgatagttgataagtag

DBGET integrated database retrieval system