KEGG   Campylobacter fetus subsp. venerealis 84-112: CSG_9350Help
Entry
CSG_9350          CDS       T03740                                 

Definition
(GenBank) ATP-dependent protease La Type I
  KO
K01338  ATP-dependent Lon protease [EC:3.4.21.53]
Organism
cfz  Campylobacter fetus subsp. venerealis 84-112
Brite
KEGG Orthology (KO) [BR:cfz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cfz01002]
    CSG_9350
Enzymes [BR:cfz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     CSG_9350
Peptidases [BR:cfz01002]
 Serine Peptidases
  Family S16: lon protease family
   CSG_9350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lon_C AAA LON_substr_bdg AAA_5 ChlI AAA_2 RuvB_N AAA_16 IstB_IS21 AAA_22 ClpB_D2-small AAA_18 RNA_helicase AAA_PrkA NTPase_1 RsgA_GTPase NACHT ABC_tran MMR_HSR1 AAA_24 ArAE_1_C AAA_33 DUF445
Motif
Other DBs
NCBI-ProteinID: CDF64846
LinkDB All DBs
Position
912518..914914
Genome map
AA seq 798 aa AA seqDB search
MQINSIRTFPANLPVIVEDELFLYPFMITPLFLNDEKNIKALDLALRDNTPILVVSSKPQ
NEGMREFDTCYSAGVIGSVMRRISLPDGRVKILFQGSQKGKIIANISSDPLIALVDTIDI
ERPSNQKVDALLSVLREKVKSLSLLNHFFPPDLLKTIDESIEATRVCDLISSALRLKKGV
AYDFFIEENLENRVLKIIDYLIEEIEANKLQKEIKSKVHSKIDKVNKEYFLKEQLKEIQK
ELGSDVGREEEISEYKNKLEAKKPYMGEDAYKEINKQILKLSRMHPDGSEASMTGSYLDW
ALDVPFGNFSKKKLGVKDVANQLDSDHYGLQKPKKRIVEYFGLRELLELRGLDSKTNNGV
ILCFAGPPGVGKTSLANSISKALKRELVRIALGGLEDVNELRGHRRTYIGAMPGRIVQGL
IEAKTMNPVVVLDEIDKLARSYKGDPTAVLLEVLDPEQNSKFRDYYLNFNVDLSKVIFIA
TANDIGLIPAPLRDRMEFISLNSYTPQEKFQIAKKYLIPSELKKHGLKPSEISITKEALS
LIIEEYTRESGVRNLRRKIADILRKVALEILENKIQKVSITPKNLKNFLDKKVFEIDSVD
STDQVGIVNGLAWTSVGGDVLKIEVVRIKGKGSMQITGQLGDVMKESAQISFSLVKTLID
TNKIKVPKSMLAKDDKGKEMAVYNSFDLHIHVPEGATPKDGPSAGITMSTAIASILSDTP
IKSDVAMTGEITLSGKVLPIGGLKEKLIAAYKAKIKTALIPRKNYDRDLEEIPSEVKENM
QIIPVDTIEDVLKLSFSK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgcagataaatagtataagaacttttccggcaaatttaccggttatcgtggaagatgag
ctgtttttgtacccttttatgataacacctctttttttaaatgatgagaaaaacataaaa
gcacttgacttggctcttagagataatactcctattttggttgtatcatcaaaaccgcaa
aatgagggtatgagagagtttgatacttgctatagcgctggagttataggaagtgttatg
agaaggatatctcttcctgatggtagagtaaaaatactttttcaaggctcacaaaaaggc
aaaatcatagccaacataagctctgatccgcttatagcgctagtagatactatagatata
gaaagaccttctaatcaaaaagtggatgcacttttgagcgtgttaagagaaaaggtaaaa
agcttaagcttattaaatcacttttttcctccagatctcttaaaaactatagatgaaagt
atagaagctactagggtttgcgatcttatttcaagtgctttaagacttaaaaaaggtgta
gcttacgacttttttatagaagaaaatttagaaaatagagtacttaaaataattgattat
ttaatagaggagatagaggctaataaactccaaaaagagataaaatcaaaagttcattct
aaaatagataaagtaaataaagagtatttcttaaaagagcagttaaaagagatacaaaaa
gagcttggtagtgatgttgggcgtgaagaagagataagtgagtataaaaataaattagaa
gccaaaaaaccgtatatgggagaagatgcttataaagagataaataagcaaattctaaaa
ctatcacgtatgcatcctgatggctcagaagctagcatgacaggaagctacttggattgg
gctttagatgtgccttttggaaatttctctaaaaaaaagctaggtgtaaaagatgtggct
aatcagcttgatagcgatcattacggactgcaaaagccaaaaaaacgcatagtcgaatat
tttgggctaagagaacttttggaacttagaggacttgattctaaaacaaataatggagtt
atactatgttttgcgggacctcctggagtaggtaaaacaagtcttgcaaactctatttca
aaagctttaaaaagagagcttgtgcgaatagccttgggcgggcttgaagacgtaaatgag
ttaagaggtcatagaagaacttatataggagctatgccggggcgaatagtgcaaggattg
atagaagctaaaaccatgaatccagtcgttgttttagatgagatagataagcttgcaaga
tcatataaaggagatccaaccgctgttttattagaagttttagatcccgagcagaactct
aaatttagggattattatctgaattttaatgtagatttaagtaaggttatatttatagcc
accgcaaatgatataggacttataccagctccgcttagagataggatggagtttatatcg
ttaaatagctacactccgcaagaaaagtttcagatagcaaaaaaatatctcattccttca
gagcttaaaaaacatggattaaaaccatctgaaatcagtataacaaaagaagctttaagc
ttgataatagaagaatatacaagagagagcggagtaagaaatttaagaagaaaaatagcc
gatatcttaagaaaagtcgctcttgagattttggaaaataagatacaaaaagtatccata
actcctaaaaatttaaaaaactttttggataaaaaagtatttgagatagatagcgtagac
agcacggatcaagtaggtatagttaacgggcttgcgtggacgagtgtcggtggagatgta
ctaaaaatcgaagttgtacgcataaaaggcaaaggatctatgcagatcacgggacagctt
ggagatgtgatgaaagagtctgcccagatatcttttagcctagttaagactcttattgat
acaaataagataaaagttccaaaatctatgcttgcaaaagacgataaaggcaaagaaatg
gcggtttataactcatttgatcttcatatccacgttcctgagggagccactccaaaagac
ggtcctagcgcaggtataactatgagtaccgccatagcgtctatacttagcgatactcct
ataaaaagcgatgttgctatgacaggagagatcactttgagtggaaaagttcttcctata
gggggattaaaggagaagctcatagcagcttataaagctaaaataaaaactgctttgatt
ccgcgtaaaaattatgatcgcgatcttgaggagataccaagcgaggtcaaagaaaatatg
cagataattcctgtagatacgatagaagatgtcctaaagttatcgttttcaaagtaa

DBGET integrated database retrieval system