KEGG   Cellulomonas gilvus: Celgi_0932Help
Entry
Celgi_0932        CDS       T01537                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cga  Cellulomonas gilvus
Pathway
cga00020  Citrate cycle (TCA cycle)
cga00480  Glutathione metabolism
cga01100  Metabolic pathways
cga01110  Biosynthesis of secondary metabolites
cga01120  Microbial metabolism in diverse environments
cga01130  Biosynthesis of antibiotics
cga01200  Carbon metabolism
cga01210  2-Oxocarboxylic acid metabolism
cga01230  Biosynthesis of amino acids
Module
cga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cga_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Celgi_0932
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Celgi_0932
Enzymes [BR:cga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Celgi_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AEI11451
UniProt: F8A032
LinkDB All DBs
Position
1016613..1017830
Genome map
AA seq 405 aa AA seqDB search
MAKIKVVGPVVELDGDEMTRIIWQFIKDRLIHPYLDIDLRYYDLSIENRDATDDQVTIDA
AHAIKEHGVGVKCATITPDEARVEEFGLKKMWVSPNGTIRNILGGVVFREPIIISNIPRL
VPGWNKPIIIGRHAHGDQYKATNFKVAGAGTLTLTFTPADGSEPIQQQVVTYPDGGGVAM
GMYNFNDSIRDFARASFAYGLQRGYPVYLSTKNTILKAYDGAFKDIFQEVFDAEFKADFD
AAGLTYEHRLIDDMVAAAMKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDG
KTVEAEAAHGTVTRHYRQHQAGKPTSTNPIASIFAWTGGLKHRGKLDATPEVTQFAQTLE
DVVITTVESGKMTKDLAQLIGPDQAWLTTEEFLAALDENLAARLA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagatcaaggtcgtcggccccgtcgtcgagctcgacggcgacgagatgacgcgc
atcatctggcagttcatcaaggaccgcctgatccacccgtacctcgacatcgacctgcgg
tactacgacctgtcgatcgagaaccgtgacgcgaccgacgaccaggtcacgatcgacgcg
gcgcacgccatcaaggagcacggcgtcggcgtcaagtgcgcgacgatcacgcccgacgag
gcgcgcgtcgaggagttcggcctgaagaagatgtgggtctcgcccaacggcacgatccgc
aacatcctcggcggcgtggtgttccgcgagccgatcatcatctcgaacatcccgcgcctg
gtgccgggctggaacaagccgatcatcatcggccggcacgcgcacggcgaccagtacaag
gcgacgaacttcaaggtcgcgggtgcgggcacgctcacgctgacgttcacgccggccgac
ggctccgagccgatccagcagcaggtggtcacgtaccccgatggcggcggcgtcgccatg
gggatgtacaacttcaacgactcgatccgcgacttcgcgcgcgcgtcgttcgcctacggc
ctgcagcggggctacccggtgtacctgtcgaccaagaacacgatcctcaaggcgtacgac
ggcgcgttcaaggacatcttccaggaggtgttcgacgccgagttcaaggccgacttcgac
gccgcgggcctgacctacgagcaccgcctgatcgacgacatggtcgccgccgcgatgaag
tgggagggcggctacgtctgggcgtgcaagaactacgacggtgacgtgcagtccgacacg
gtcgcgcagggcttcggctcgctgggcctcatgacgtcggtgctcatgacgccggacggc
aagacggtcgaggcggaggccgcgcacggcaccgtgacgcgccactaccgccagcaccag
gcgggcaagccgacgtcgaccaacccgatcgcgtcgatcttcgcgtggaccggcgggctc
aagcaccgcggcaagctggacgcgacgcccgaggtcacgcagttcgcgcagacgctcgag
gacgtcgtcatcacgacggtcgagagcggcaagatgaccaaggacctcgcgcagctcatc
ggtccggaccaggcgtggctcaccaccgaggagttcctggccgcgctcgacgagaacctc
gcggcccgtctggcctga

DBGET integrated database retrieval system