KEGG   Cellulomonas gilvus: Celgi_1436Help
Entry
Celgi_1436        CDS       T01537                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
cga  Cellulomonas gilvus
Pathway
cga00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cga01100  Metabolic pathways
cga01110  Biosynthesis of secondary metabolites
cga01130  Biosynthesis of antibiotics
cga01230  Biosynthesis of amino acids
cga02024  Quorum sensing
Module
cga_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:cga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Celgi_1436
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Celgi_1436
Enzymes [BR:cga01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Celgi_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2 ETF
Motif
Other DBs
NCBI-ProteinID: AEI11955
UniProt: F8A3Q2
LinkDB All DBs
Position
1567552..1568904
Genome map
AA seq 450 aa AA seqDB search
MSVEPDPQVVAGLDAWRSLPAGQQPAWPDADALARVTDRLAALPPLVFAGEADALRAQLA
AAGRGEAFLLQGGDCAETFAEATADNIRNKIKTILQMAVVLTYGASLPVVKMGRMAGQYA
KPRSSDSETRDGVTLPAFRGDIINGFDFTPEARTPDPQRLLEAYHTSASTLNLIRAFTTG
GFASLLRVHEWNKGFTTNPAYARYEEIAAEIDRAIRFMAACGADFDALRTVDFYSSHEGL
LLDYERPLTRIDSRTGLPYDCSAHFVWIGERTRELGGAHIDYFSRVQNPLGVKLGPTSTG
DDAIALIDALNPTGEPGRLTFVTRMGAGKIRDRLPALVEKVAADGRPVTWVCDPMHGNGI
TSATGYKTRRFSDVMDEVAGFFEVHRALGTVPGGLHIELTGDDVTEVLGGAEEIDDERLA
ERYETLVDPRLNHQQSLELAFQVVELLRAA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtggagccggacccgcaggtggtcgccgggctcgacgcctggcgatccctgccc
gcgggtcagcagccggcgtggccggacgccgacgcgctcgcgcgggtgacggaccggctc
gccgcgctgcccccgctcgtgttcgcgggcgaggcggacgcgctgcgggcgcagctcgcg
gcggcaggtcggggtgaggcgttcctgctccagggcggcgactgcgccgagacgttcgcc
gaggcgaccgcggacaacatccggaacaagatcaagacgatcctgcagatggccgtcgtg
ctgacgtacggcgcgagcctgccggtcgtgaagatgggccggatggcggggcagtacgcc
aagccgcgttcctcggacagcgagacgcgggacggggtcacgctcccggcgttccggggc
gacatcatcaacggcttcgacttcacacccgaggcgcggacgcccgacccgcagcggctc
ctcgaggcctaccacacgtccgcgtcgacgctgaacctcatccgggcgttcaccacgggc
ggcttcgcgtcgctgctgcgcgtgcacgagtggaacaagggcttcacgacgaaccccgcg
tacgcgcggtacgaggagatcgcggccgagatcgaccgcgcgatccggttcatggccgcg
tgcggcgccgacttcgacgcgctgcgcacggtggacttctactcctcgcacgaggggctg
ctgctcgactacgagcgcccgctcacgcgcatcgacagccgtacgggtctgccgtacgac
tgctcggcgcacttcgtgtggatcggggagcgcacgcgtgagctcggtggcgcgcacatc
gactacttctcgcgcgtgcagaaccccctgggcgtcaagctcggcccgacctccacgggc
gacgacgcgatcgcgctgatcgacgcgctcaacccgacgggggagccggggcgcctcacg
ttcgtgacgcggatgggcgcgggcaagatccgtgaccggctcccggctctcgtcgagaag
gtcgcggctgacggccgtccggtgacgtgggtgtgcgacccgatgcacgggaacggcatc
acgtcggcgacgggctacaagacgcgccgcttctccgacgtgatggacgaggtcgcgggc
ttcttcgaggtgcaccgcgcgctgggcaccgtccccggcgggctgcacatcgagctcacg
ggcgacgacgtgaccgaggtcctcggcggcgccgaggagatcgacgacgagcggctcgcg
gagcgctacgagacgctcgtggacccgcgcctgaaccaccagcagtcgctcgagctcgcg
ttccaggtggtggagctgctgcgcgcagcctga

DBGET integrated database retrieval system