KEGG   Cellulomonas gilvus: Celgi_1437Help
Entry
Celgi_1437        CDS       T01537                                 

Definition
(GenBank) serine/threonine protein kinase with PASTA sensor(s)
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cga  Cellulomonas gilvus
Brite
KEGG Orthology (KO) [BR:cga00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cga01001]
    Celgi_1437
Enzymes [BR:cga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Celgi_1437
Protein kinases [BR:cga01001]
 Serine/threonine kinases: Other
  Bacterial family
   Celgi_1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like Kdo Haspin_kinase ABC1
Motif
Other DBs
NCBI-ProteinID: AEI11956
UniProt: F8A3Q3
LinkDB All DBs
Position
complement(1568977..1571010)
Genome map
AA seq 677 aa AA seqDB search
MGTAVTDPLVGRLVDGRYEVVSRIARGGMATVYLAVDRRLDRDVALKVMHPHLAEGTSGA
DFVARFRREARAAARLTHPGLVGVFDQGVDGETSYLTMEYVDGSNLRRRLGEQGALTVAD
ALRITEAVLDALGAAHRAGLVHRDIKPENVLLSSEDRVKLADFGLARAVTEVTATTTGTV
LGTVAYLAPELVVRGSSDARTDVYACGILLFEMLTGRQPYTGETPIQVAFQHVNSDIPAP
SDVVSWLPVELDDLVRALAAREPDDRPVDAGAAVTLLRRVRSELDPQTLERRADVPATIV
LPAATDPDETPLPDDDPPGPVAAALDDATDPGATMLIDASTHHGSTVALPIGLGAGLPSV
VAAAPQPAAVTPPPRRRRRALAIGLVLLVALLLGGAGWWYVAAGPGAYTTVPPIAGKSTD
AATGALEALGLHPDVSSEFSDTVAKGLVVASDPASGDRVRKDGTVEVVVSKGPDYVDVPD
GVVGTLQADAEKALEDAGLEVDYAPAVYDDKAGLGVVVAATLPDGSDADAGTRTTRHTVV
TLTVSKGPEPLTVRNVVGKSAQDATKQLKADGLKVKTTEAFSDDVDQGLVISQDPRAKSD
GHRGDTVTLVVSKGPELVEVPDLFGMQFEKAAKELEKRGLVAAREDFLGGVFGTVRDQSV
RAGESVPKGTVVTLTVV
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaccgccgtcacagatccgctcgtgggccgcctggtcgacgggcggtacgaggtc
gtctcccgcatcgcccgcggtggcatggcgaccgtctacctggccgtcgaccgccgcctg
gaccgcgacgtcgcgctcaaggtcatgcacccgcacctggccgaggggacgtccggcgcc
gacttcgtcgcgcggttccggcgcgaggcgcgcgcggccgcccggctgacgcaccccggc
ctggtcggcgtgttcgaccagggcgtcgacggcgagacgtcctacctgacgatggagtac
gtcgacgggtcgaacctgcgccgtcggctcggcgagcagggcgcgctgacggtcgccgac
gcgctgcgcatcaccgaggccgtgctggacgcactcggggcggcgcaccgcgcggggctg
gtgcaccgcgacatcaagcccgagaacgtgctgctgtccagcgaggaccgcgtcaagctc
gccgacttcgggctcgcccgcgccgtgaccgaggtgaccgcgacgacgaccgggaccgtg
ctgggcacggtcgcctacctggcgcccgagctcgtggtgcgcggctcgagcgacgcgcgc
accgacgtgtacgcgtgcggcatcctgctgttcgagatgctcacgggccggcagccgtac
accggcgagacgccgatccaggtggcgttccagcacgtcaactcggacatccccgcgccc
tccgacgtcgtgagctggctgccggtcgagctcgacgacctggtccgcgcgctggccgcg
cgcgagcccgacgaccgccccgtcgacgcgggcgcggcggtcacgctgctgcgtcgggtg
cgctccgagctggacccgcagacgctcgagcgccgcgccgacgtccccgcgacgatcgtg
ctcccggccgcgaccgacccggacgagacgcctctgccggacgacgacccgcccggcccc
gtggccgcggcgctggacgacgcgaccgatcccggcgcgacgatgctgatcgacgcgtcc
acgcaccacggctcgaccgtcgcgctgcccatcggcctgggcgcaggcctgccgtccgtc
gtcgccgcggcgccgcagccggccgccgtcacgccgcccccacgccgccgacgccgcgcg
ctggcgatcggcctcgtgctgctcgtcgcactcctgctcggtggcgcgggctggtggtac
gtcgccgcgggtccgggcgcctacacgaccgtgccgccgatcgcgggcaagagcaccgac
gcggcgacgggtgcgctcgaggcgctcgggctgcaccccgacgtgagctcggagttctcc
gacaccgtggcgaagggtctcgtggtcgccagcgaccccgcatcgggcgaccgcgtccgc
aaggacggcaccgtcgaggtcgtcgtgtcgaaggggccggactacgtcgacgtcccggac
ggcgtcgtcggcacgctgcaggcggacgccgagaaggcactcgaggacgccggcctcgag
gtcgactacgcgcccgcggtgtatgacgacaaggccggcctgggcgtggtcgtggccgcg
accctgcccgacggcagcgacgcggacgcgggcacgcggaccacgcggcacacggtggtc
acgctgaccgtctcgaagggacccgagccgctcacggtgcgcaacgtggtcggcaagagc
gcgcaggacgccaccaagcagctcaaggccgacggtctcaaggtcaagacgaccgaggcg
ttcagcgacgacgtcgaccaggggctcgtcatcagccaggacccgcgcgcgaagtccgac
gggcaccggggtgacacggtgacgctcgtggtctccaagggccccgagctggtcgaggtg
ccggacctgttcggcatgcagttcgagaaggcggcgaaggagctcgagaagcgtggcctg
gtggctgcgcgcgaggacttcctgggcggcgtcttcggcacggtccgggaccagagcgtc
cgggccggcgagtcggtccccaagggcaccgtggtgacgctcacggtcgtgtga

DBGET integrated database retrieval system