KEGG   Cellulomonas gilvus: Celgi_1690Help
Entry
Celgi_1690        CDS       T01537                                 

Definition
(GenBank) DNA polymerase LigD, ligase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cga  Cellulomonas gilvus
Pathway
cga03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cga00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Celgi_1690
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cga03400]
    Celgi_1690
Enzymes [BR:cga01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Celgi_1690
DNA repair and recombination proteins [BR:cga03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Celgi_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AEI12201
UniProt: F8A5P6
LinkDB All DBs
Position
complement(1836537..1837469)
Genome map
AA seq 310 aa AA seqDB search
MQPMLATPAPSGVLPRGAAWAFEVKWDGVRVLAEVEGGLVRLLSRTGRPVTPAYPELAGL
AHLPDVLLDGEVVALEGGVPSFAAIADRMHVRDPRRAAELARVRPVTFMVFDVLRVAGAD
VVERPYDERRRLLEALDLPEHVLLSPVHDDGDGLWDVTRAHGLEGVVAKRRASPYRPGAR
SGDWVKAAHRRTRTAYVAGWRPEQGGSGRLGALLLGAPDRDGALRFLGRAGSGVSGPLAT
RLRTSALGLARDTSPFADTVPAVDARGSHWCVPELVVDVRYLGRGREGRLRQPVVRGLRD
DATVDPWEQE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcccatgctcgccacccctgcgccctcgggcgtgctgccacgcggtgccgcgtgg
gcgttcgaggtgaagtgggacggggtccgggtgctcgcggaggtcgagggcgggctggtg
cgtctgctcagccgcacgggacgccctgtgacgcccgcgtaccccgagctcgcgggcctc
gcgcacctgccggacgtgctgctggacggcgaggtggtcgcgctcgagggcggcgtgccg
tcgttcgcggcgatcgccgaccgcatgcacgtgcgcgacccgcgccgtgccgccgagctc
gcgcgcgtgcggccggtcacgttcatggtgttcgacgtgctgcgcgtcgcgggtgccgac
gtcgtcgagcgcccctacgacgagcgtcgccggctgctcgaggcgctcgacctgcccgag
cacgtgctgctgtccccggtgcacgacgacggcgacggcctgtgggacgtgacgcgcgcg
cacggcctcgagggtgtcgtcgccaagcgccgtgcctcgccctaccggcccggggcgcgc
tcgggcgactgggtcaaggcggcgcaccgccggacccggaccgcctacgtcgcgggctgg
cggcccgagcagggcgggtccgggcggctgggcgcgctgctgctgggcgcgccggaccgc
gacggtgcgctgcggttcctggggcgcgcgggcagcggcgtgtccggccctctcgcgacg
cgcctgcgcaccagcgcgctcggcctggcccgggacacgagcccgttcgcggacacggtg
cccgcggtcgacgcacgcggctcgcactggtgcgtcccggagctggtggtcgacgtgcgc
tacctgggccgtggccgcgaggggcggctgcgccagcccgtcgtgcgcgggctgcgcgac
gatgcgaccgtcgacccgtgggagcaggagtga

DBGET integrated database retrieval system