KEGG   Cellulomonas gilvus: Celgi_2305Help
Entry
Celgi_2305        CDS       T01537                                 

Definition
(GenBank) ATP dependent DNA ligase
Organism
cga  Cellulomonas gilvus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEI12805
UniProt: F8A147
LinkDB All DBs
Position
2530922..2531980
Genome map
AA seq 352 aa AA seqDB search
MRLPVMPPVAPMLARSVKDIPDVGHVEPKWDGFRTIVFRDGDEVELGSRNEKPLTRYFPE
LVEQIKAHTPDRCVLDGEIVIVEGDHLAWDALTNRIHPAASRVRLLAEQTPASLVAFDLL
ALGDEDLMGAPLRDRRRRLVDALGEAHSPVHVTPATADMDEAHRWFTQFEGAGLDGVVAK
PLDGTYQPDKRAMFKVKHERTADCVVAGFRWHKTGGILGSLLLGLWDDEGHLQHVGVAAS
FPMARRAALIEELAPLRTDVGDHPWAQWADSDAHAGNRLPGAVSRWNATKDLSFEPLRPE
LVVEVAYDHMEGTRFRHTAQFRRWRPDRDPATCTYAQLETPVRFDLADVLGG
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgcccgtgatgccgccggtcgcccccatgctcgccaggtcggtcaaggacatc
cccgacgtggggcacgtcgaacccaagtgggacggcttccgcacgatcgtgttccgcgac
ggcgacgaggtggagctcggcagccgcaacgagaagccgctgacgcgctacttcccggag
ctggtcgagcagatcaaggcccacacaccggaccgctgcgtgctcgacggcgagatcgtc
atcgtcgagggcgaccacctggcctgggacgcgctcacgaaccgcatccaccccgcggcg
tcgcgcgtgcggctcctcgcggagcagacccccgcgagcctcgtcgcgttcgacctcctg
gccctgggcgacgaggacctgatgggtgctccgctgcgggaccggcgccgacggctcgtg
gacgcgctcggcgaggcgcactcccccgtccacgtcacacccgccacggcggacatggac
gaggcgcaccgctggttcacgcagttcgagggcgcgggcctggacggcgtcgtcgccaag
ccgctggacggcacgtaccagccggacaagcgcgcgatgttcaaggtcaagcacgagcgc
accgccgactgcgtggtcgccgggttccggtggcacaagaccggcgggatcctcggcagc
ctgctgctgggcctgtgggacgacgaggggcacctccagcacgtgggcgtcgcggcgtcg
ttccccatggcgcggcgtgcggcgctcatcgaggagctcgcgccgctgcggaccgacgtg
ggcgaccacccctgggcgcagtgggcggacagcgacgcgcacgcgggcaaccggctgccg
ggcgcggtcagccgctggaacgcgaccaaggacctcagcttcgagccgctgcgccccgag
ctggtggtcgaggtggcctacgaccacatggaggggacgcgcttccggcacaccgcgcag
ttccggcggtggcgcccggaccgggacccggccacgtgcacgtacgcgcagctcgagaca
cccgtgcggttcgacctcgcggacgtcctgggcggctga

DBGET integrated database retrieval system