KEGG   Cellulomonas gilvus: Celgi_2528Help
Entry
Celgi_2528        CDS       T01537                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
cga  Cellulomonas gilvus
Brite
KEGG Orthology (KO) [BR:cga00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Celgi_2528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: AEI13027
UniProt: F8A2N4
LinkDB All DBs
Position
complement(2801717..2802727)
Genome map
AA seq 336 aa AA seqDB search
MSTKHEVIEPAAGSGAAHVHAAAAVGEPVAAPRTGLPARLVARAKAALAWWQATRPARAN
ARFGARGGGVLTGGIAYAALFSVFAALTLGWTVFMALLGGDADLRGRVLTAIDEALPGLV
QTDDAGSGLIDPDTLRMSAGLTVAGAVALVVLLMSALSAAAALRTGVRAMFAADGASGTG
GENVVLGKLRELGGLAGLAFAVLLSAVLTTAVTAGAQWLLGELGWAGATTVVLRVCGLLV
TFVLDAAVFVLVVRVLANQHPPRRDLLRGAAICALGVGVVRFLGTSVVAGSATKNPVLAS
FAVIVTLLVWVNLMARIVLLSAAWTADPRPAPDPCD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacgaagcatgaggtgatcgagccggccgcggggtccggcgcggcgcacgtgcac
gccgcggcggccgtgggcgagccggtcgccgccccccgcaccgggctgccggcccggctc
gtcgcgcgcgcgaaggccgccctcgcgtggtggcaggcgacccgccccgcgcgcgccaac
gcacggttcggtgcgcgcggcggtggcgtgctcacgggcgggatcgcgtacgcggcgctg
ttctcggtcttcgcggccctcacgctgggctggaccgtcttcatggcgctgctcggcggc
gacgcggacctgcgggggcgcgtcctgacggcgatcgacgaggcgctgccgggactcgtg
cagaccgacgacgcgggctcgggcctgatcgacccggacaccctgcgcatgtccgcgggc
ctgaccgtggccggggccgtggcgctcgtcgtgctgctcatgtcggcgctgtcggccgcc
gcggcgctgcgcacgggtgtgcgcgcgatgttcgcggccgacggcgcgagcggcaccggc
ggcgagaacgtcgtgctgggcaagctccgcgagctcggcgggctcgcgggcctcgcgttc
gcggtgctgctgtccgcggtcctgaccaccgccgtcacggcgggcgcgcagtggctgctc
ggcgagctgggctgggccggcgccaccacggtcgtgctgcgcgtctgcggcctgctcgtg
acgttcgtgctcgatgcggcggtgttcgtgctcgtcgtccgggtcctggccaaccagcac
ccgccgcggcgggacctgctccggggcgccgcgatctgcgcgctcggcgtgggcgtcgtg
cggttcctgggcacgtcggtggtcgcgggcagcgccaccaagaacccggtgctcgcgtcg
ttcgcggtgatcgtgacgttgctggtctgggtcaacctgatggcccggatcgtgctgctc
tcggccgcgtggaccgcggacccgcggccggcccccgatccctgcgactga

DBGET integrated database retrieval system