KEGG   Cellulomonas gilvus: Celgi_2873Help
Entry
Celgi_2873        CDS       T01537                                 

Definition
(GenBank) cold-shock DNA-binding domain protein
  KO
K03704  cold shock protein
Organism
cga  Cellulomonas gilvus
Brite
KEGG Orthology (KO) [BR:cga00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    Celgi_2873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: AEI13366
UniProt: F8A5S6
LinkDB All DBs
Position
3170559..3170762
Genome map
AA seq 67 aa AA seqDB search
MATGTVKWFNAEKGFGFIAPDDGGPDVFAHYSAIQSSGFRSLEENQKVEFEITEGQKGPQ
ASNIHPL
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atggcaactggcaccgtgaagtggttcaacgccgagaaggggttcggcttcatcgcgccc
gacgacggcggaccggacgtcttcgcccactactcagccatccagtcgagcggcttccgc
tcgctggaggagaaccagaaggtcgagttcgagatcaccgagggccagaagggcccgcag
gcctcgaacatccaccccctctga

DBGET integrated database retrieval system