KEGG   Corynebacterium glutamicum ATCC 13032 (Bielefeld): cg2388Help
Entry
cg2388            CDS       T00244                                 

Gene name
pknL
Definition
(GenBank) PUTATIVE SERINE/THREONINE PROTEIN KINASE
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cgb  Corynebacterium glutamicum ATCC 13032 (Bielefeld)
Brite
KEGG Orthology (KO) [BR:cgb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cgb01001]
    cg2388 (pknL)
Enzymes [BR:cgb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     cg2388 (pknL)
Protein kinases [BR:cgb01001]
 Serine/threonine kinases: Other
  Bacterial family
   cg2388 (pknL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-ProteinID: CAF20516
LinkDB All DBs
Position
2274434..2276656
Genome map
AA seq 740 aa AA seqDB search
MANLKVGDVLEDRYRIETPIARGGMSTVYRCLDLRLGRSMALKVMEEDFVDDPIFRQRFR
REARSMAQLNHPNLVNVYDFSATDGLVYLVMELITGGTLRELLAERGPMPPHAAVGVMRG
VLTGLAAAHRAGMVHRDIKPDNVLINSDHQVKLSDFGLVRAAHAGQSQDNQIVGTVAYLS
PEQVEGGEIGPASDVYSAGIVLFELLTGTTPFSGEDDLDHAYARLTEVVPAPSSLIDGVP
SLIDELVATATSINPEDRFDDSGEFLSALEDVATELSLPAFRVPVPVNSAANRANAQVPD
AQPTDMFTTHIPKTPEPDHTAIIPVASANETSILPAQNMAQNMAQNPLQPPEPDFAPEPP
PDTALNIQDQELARADEPEINTVSNRSKLKLTLWSIFVVAVIAAVAVGGWWFGSGRYGEI
PQVLGMDEVQAVAVVEEAGFVAVAEPQYDNEVPTGSIIGTEPSFGERLPRGEDVSVLVSQ
GRPVVPDLSEDRSLSTVREELEQRTFVWVDGPGEYSDDVPEGQVVSFTPSSGTQLDVGET
VQIHLSRGPAPVEIPDVSGMGVDQATRVLERAGLSVERTEEGFDAETPNGDVYGTSPKVS
TEVKRGTSVVLQVSNAISVPDVVGMTKDEATAALAEEGLVVASTSIIPGEAASSADAVVT
VEPESGSRVDPAHPQVSLGLAGEIQVPSVVGRKVSDARSILEEAGLTLTTDADDNDRIYS
QTPRARSEVSVGGEVTVRAF
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacttgaaggtcggtgacgttttagaggacaggtatcggattgaaactccgatt
gcccggggtggtatgtctaccgtgtacaggtgccttgatcttcgtttaggacgttccatg
gcgcttaaagtcatggaagaagatttcgttgatgatcccattttccggcagcgtttccgt
agggaagctcggtcaatggcgcagctaaatcatccaaatttggtcaatgtgtatgatttt
tccgctactgacggtttggtgtatctggtgatggagttaatcactggtggcaccttgcgt
gagttgctggctgagcggggacctatgcccccgcatgctgctgtgggcgttatgcgtggg
gtgctcacgggtctcgcggctgcccaccgggcgggcatggtgcaccgggatatcaagcct
gacaacgtgttgatcaatagtgatcaccaggtgaaactgtctgatttcggcttggttcga
gcggctcacgccggccagtctcaggacaatcagattgtgggcacggtggcttatctttcc
cctgagcaggttgagggcggtgagatcgggccggccagcgacgtgtattcggcaggcatt
gtgctctttgagctgctcacaggcaccacgcctttttcgggcgaggatgatctcgaccat
gcatacgcccgccttacggaagtcgtgccggcaccgagttcgcttatcgacggcgtcccc
tccctcatcgatgagcttgtcgcgacagctacctccattaatcctgaggatcgtttcgat
gattctggagagtttttgtccgcactggaagatgtcgcaacagagttgagcttgccggct
ttccgggtccctgtgccggttaattccgcagccaatagggctaatgcccaggtcccggat
gctcagccaactgatatgtttaccacccatatccccaagactcctgagcctgatcacact
gcgatcattccggtggcctcagcaaatgagacgtcgattctgcctgcgcaaaacatggca
caaaatatggcgcagaatccgctgcaacctccggaacctgatttcgccccggagccacct
ccggacacagcgctgaatattcaagatcaagagcttgcgcgcgccgatgagccagaaatt
aataccgtcagcaatcgttccaaattgaagctgacgttgtggtcaattttcgtggtcgca
gtgatcgctgctgttgctgttggcggttggtggttcggttcaggccgttacggtgagatt
ccgcaggtgttgggcatggatgaggtccaggcagtagctgttgtagaggaagctggtttc
gtggcagtggctgaacctcagtatgacaatgaggttcccactggttcgattattgggact
gaaccttcttttggtgagcgccttcctcgcggcgaggatgtttctgtcctcgtctctcaa
gggcgtcccgtggtgccggatcttagcgaggatcgatccttaagcaccgttcgtgaagag
ttggaacagcgcacgttcgtctgggttgatggcccaggtgaatattctgacgatgttcca
gaaggacaagtagtttcttttacaccgtcgtcaggcacgcagcttgatgttggtgaaacc
gtgcagatccatttgagccgaggccccgccccggttgagattcctgatgtctctggcatg
ggagtggatcaggcaacacgtgtgttggagcgcgcaggtttgagcgtcgagcgtactgaa
gaaggctttgatgctgagacaccaaatggtgatgtctacgggacttcgcccaaggtatct
actgaggtcaagcgcggaacctctgttgtgctgcaggtgtccaatgctatttcggtaccg
gatgtggtgggtatgaccaaggacgaagccaccgcggcgcttgcggaagaaggattggtc
gtggcgtcgacaagcattattcctggtgaggcggcgagctccgctgacgccgtcgtgacc
gtcgagcctgaatccggcagccgcgttgatccagcgcatccgcaggtcagcctcgggtta
gctggggagattcaagttccaagcgtggttggacgtaaggttagcgatgctcgaagcatt
ctggaagaagccggtttaacgctgacaactgatgcggacgacaacgatcgaatttatagt
caaacccctcgtgcacgcagcgaagtctcggtagggggagaagttacagtaagggcgttt
tag

DBGET integrated database retrieval system