KEGG   Cyanobium gracile: Cyagr_0013Help
Entry
Cyagr_0013        CDS       T02359                                 

Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cgc  Cyanobium gracile
Pathway
cgc00630  Glyoxylate and dicarboxylate metabolism
cgc00710  Carbon fixation in photosynthetic organisms
cgc01100  Metabolic pathways
cgc01120  Microbial metabolism in diverse environments
cgc01200  Carbon metabolism
Module
cgc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cgc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cgc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Cyagr_0013
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyagr_0013
Enzymes [BR:cgc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Cyagr_0013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: AFY27234
UniProt: K9P3U4
LinkDB All DBs
Position
complement(13001..13342)
Genome map
AA seq 113 aa AA seqDB search
MPFKSTVGDYQTVATLETFGFLPPMTQDEIYDQIAYIIAQGWSPLVEHVHPSRSMATYWS
YWKLPFFGEKDLGVIVNELESCHRAYPDHHVRLVGYDAYTQSQGACFVVFEGR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcaagagcaccgtgggtgactatcaaacagtcgccaccctggagaccttcggc
ttcctcccgccgatgacccaggacgagatctacgaccagatcgcctacatcattgcccag
ggctggagtcccctggtcgagcacgtccaccccagccgctccatggccacctactggtcg
tactggaagctgcccttcttcggtgagaaggatctcggtgtgatcgtcaacgaactggag
tcctgccaccgggcctaccccgaccaccacgtgcgcctcgtcggttacgacgcctacacc
cagagccagggcgcctgcttcgtcgtgttcgaaggccgctga

DBGET integrated database retrieval system