KEGG   Cyanobium gracile: Cyagr_1287Help
Entry
Cyagr_1287        CDS       T02359                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cgc  Cyanobium gracile
Brite
Enzymes [BR:cgc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cyagr_1287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFY28463
UniProt: K9P674
LinkDB All DBs
Position
1299961..1300560
Genome map
AA seq 199 aa AA seqDB search
MAHRLPELPYGLDALEPHISRQTLEFHHGKHHAAYVTNLNKAIEGGELEGKSLEEVILAV
AGDASKAGVFNNAAQVWNHSFYWQCMKPGGGGAPTGELAEKITADFGSYEAFVEQFKAAG
ATQFGSGWAWLVLDGGTLKITKTANADLPLAHGQKALLTMDVWEHAYYLDYQNRRPDYMT
TYLDKLVNWDFVAANLAAA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggctcaccgcctgcccgaactcccctacggcctcgacgcactcgagccccacatttcc
cggcagaccctcgagttccaccacggcaagcatcacgccgcctacgtcaccaacctgaac
aaggcgatcgagggtggcgagctcgagggcaagagcctggaggaggtgatcctggcggtg
gccggcgacgcctccaaggcgggcgtgttcaacaacgccgcccaggtctggaaccacagc
ttctactggcagtgcatgaagcctggcggcggcggcgcccccaccggtgagctggccgag
aagatcaccgccgacttcggcagctatgaggccttcgtggagcagttcaaggccgccggt
gccacccagttcggcagcggctgggcctggctggtgctcgatggcggcaccctcaagatc
accaagaccgccaacgccgacctgcccctggcccatggtcagaaggccctgctcaccatg
gacgtgtgggagcacgcctactacctcgactatcagaaccgccgtcctgactacatgacc
acctacctcgacaagctggtcaactgggactttgtggccgccaacctggccgccgcctga

DBGET integrated database retrieval system