KEGG   Cyanobium gracile: Cyagr_1349Help
Entry
Cyagr_1349        CDS       T02359                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cgc  Cyanobium gracile
Pathway
cgc00473  D-Alanine metabolism
cgc00550  Peptidoglycan biosynthesis
cgc01100  Metabolic pathways
cgc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cgc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Cyagr_1349
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cyagr_1349
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Cyagr_1349
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cgc01011]
    Cyagr_1349
Enzymes [BR:cgc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Cyagr_1349
Peptidoglycan biosynthesis and degradation proteins [BR:cgc01011]
 Precursor biosynthesis
  Amino acid ligase
   Cyagr_1349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AFY28522
UniProt: K9P547
LinkDB All DBs
Position
1358810..1359925
Genome map
AA seq 371 aa AA seqDB search
MAPTPTRVGLVFGGASGEHAVSILSARTVLRGLRSGANAERYRVSSFYIDRGGRWWPDVV
AAAVLERGVPAEPADLPGPAEPGGFRGFPDGALEMEVWFPVLHGPNGEDGTIQGLFTLMG
VPYVGSGVLGSALGMDKQAMKAAFAAAGLPQVPYACVAAHELTGDASGTEALLERLESSL
GYPCFVKPANMGSSVGISKASDRAGLLGGLELAAGLDRRLVVEQGVRARELECAVLRRPG
GPGDGLSASVLGEIRFDADWYDYETKYSEGHSHTVIPAPVDAAVSERARTMALAACRAVD
AGGLARVDFFYDEATGNLWLNEINTLPGFTSQSMYPMLWEASGCPLPDLVHQLVLGAGGS
ELRMNVEGTAP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcccccacccccacccgcgtcggcctggtgttcgggggagcctccggcgaacacgcc
gtctcgatcctttcggcccgcaccgtgctgcggggcctgcgcagcggggccaatgccgag
cgttaccgggtcagcagcttctacatcgatcgcggcggccgctggtggcccgatgttgtg
gccgcggcggtgctggagcggggcgtgccggccgaacccgcggatctgccgggaccggcg
gagccggggggcttccggggcttccccgacggcgccctggagatggaggtgtggttcccg
gtgctccatggccccaacggagaggacggcacgatccagggactgttcaccctgatgggg
gtgccctacgtgggctccggggtgctgggatcggcgctcggaatggacaagcaggcgatg
aaggccgccttcgccgccgccggcctgccccaggtgccctacgcctgcgtcgccgcccac
gagctgaccggcgatgccagcgggacagaggccctgctggagcggctggagagcagcctc
ggctacccctgcttcgtcaagccggccaacatgggctcctcggtgggcatcagcaaggcc
agcgaccgtgccggcctgctggggggcctcgagctggccgcgggcctcgaccggcggctg
gtggtggagcagggcgtcagggcccgggagctcgaatgcgccgtgctgaggcggcccggg
ggcccgggcgacggcctcagcgcctcggtgttgggggagatccgcttcgacgccgattgg
tacgactacgagaccaagtacagcgaaggccacagccacaccgtcatccccgcgcccgtg
gacgcggcggtgagcgagcgggcccggaccatggcgctggccgcctgccgggcggtggac
gccggggggctggcccgggtcgacttcttctacgacgaagccacaggcaacctctggctg
aacgagatcaacacgctgccgggcttcaccagccagagcatgtacccgatgctgtgggag
gccagtggatgtcctctccccgacctggtgcaccaattggtgctgggcgcgggaggatcg
gagctccggatgaacgtggaaggaacggcgccgtga

DBGET integrated database retrieval system