KEGG   Cyanobium gracile: Cyagr_1666Help
Entry
Cyagr_1666        CDS       T02359                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cgc  Cyanobium gracile
Pathway
cgc00620  Pyruvate metabolism
cgc00680  Methane metabolism
cgc00710  Carbon fixation in photosynthetic organisms
cgc01100  Metabolic pathways
cgc01120  Microbial metabolism in diverse environments
cgc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cyagr_1666
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyagr_1666
   00680 Methane metabolism
    Cyagr_1666
Enzymes [BR:cgc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cyagr_1666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFY28816
UniProt: K9P7Y8
LinkDB All DBs
Position
1636003..1639008
Genome map
AA seq 1001 aa AA seqDB search
MRLHLTEPSVVPAEASPGVIRLLTERLELVEDLWQTVLRSECPPEQVDRLLRLKELSGPV
APGLDPEAPSAVDTDGIVALIKAMDLAEGIAAARAFSLYFQLVNILEQHIEEDSYLESIK
RAPAPASNDPFLPPLASQSDPATFRQLFERLRALNVPPGQLEGLLRELDIRLVFTAHPTE
IVRHTVRHKQRRVAALIQKLQVNGQGNPDDNDRLRQQLEEEIRLWWRTDELHQFKPSVID
EVDYALHYFQQVLFDALPQLRQRIRAALAASYPDVQPPRDAFCTFGSWVGSDRDGNPSVT
PDVTWRTACFQRQLMLARYIQSVSVLRDQLSISMQWSQVSAALLESLEMDRLRFPEIYEE
RAARYRLEPYRLKLSYTLERLRLTQQRNQQLAEAGWESPCDGSSGYEAGLSSLMEPAPPQ
ELHYASVEEFRTDLELIKESLDATGLSCEALQDLLSQVHIFAFSLASLDIRQESTRHSDA
IDELSRYLLLPVPYGEMDEEQRVEWLLSELKTRRPLLPPAARWSAPTAETFAVFRMLQRL
QQEFGRRICRTYVISMSHTVSDLLEVVLLAKEAGLVDPMAQKSALLVIPLFETVEDLQGA
PAVMGRLFADPFYRQLLISNSDGEQPLQEVMLGYSDSNKDSGFLSSNWEIHRAQIALQSL
ADAHDVALRIFHGRGGSVGRGGGPAYQAILAQPSGTLKGRIKITEQGEVLASKYSLPELA
LYNLETVTTAVLQNSMVSTPVDDTPTWNVLMERLAARSRDHYRALVHDNPDLVAFFQQVT
PIEEISKLQISSRPARRKSGAKDLSSLRAIPWVFGWTQSRFLLPSWYGVGTALQAELDAD
GEQMELLQLLYQRWPFFRMLISKVEMTLSKVDLELAGHYVTSLGRPQNREVFAQIFEAIA
SEFALTHSLVLRISNHSRLLDGDPALQLSVDLRNRTIIPLGYLQVALLRRLREQKRQPPM
SEGPGDGPGGGGDGRTYSRSELLRGALLTINGIAAGMRNTG
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgcggctccacctgaccgagccttcggtcgttcccgccgaggcctcacccggggtgatc
cgactgctcaccgagcggctggagctggtggaggatctctggcagacggtgctgcgcagt
gaatgcccgcccgagcaggtggatcgtctgctgcggctcaaggaactgagcggtccggtg
gcgccgggcctggatcctgaggccccctccgccgtcgacaccgacggcatcgtggccctg
atcaaggccatggatctggccgagggcatcgccgcagccagggccttctcgctctacttc
cagctggtcaacatcctcgagcagcacatcgaggaggacagctacctcgaaagcatcaag
cgggcccccgcccccgccagcaacgacccgttcctgccgcccctggccagccagagcgat
ccggccaccttccgccagctgttcgagcggctgcgcgccctcaatgtgcccccgggccag
ctggaggggctgctgcgggagctcgacatccggctggtgttcacggcccaccccaccgag
atcgtgcgccacaccgtgcgccacaagcaacggcgggtggcggccctgatccagaagctt
caggtgaacggccagggcaacccggacgacaacgaccggctgcgccagcagctcgaggag
gagatccggctgtggtggcgcaccgacgagctgcaccagttcaagccgtcggtgatcgat
gaggtcgattacgccctccactacttccagcaggtgctcttcgatgccctgccccagctg
cgccagcgcatccgcgccgcccttgccgccagctaccccgacgtgcagcccccccgggac
gccttctgcaccttcggttcctgggtgggatccgaccgggacggcaacccctcggtgacc
ccggacgtgacctggcgcacggcctgcttccagcggcagctgatgctggcccgctacatc
cagtcggtgtcggtcctgcgcgaccagctcagcatctcgatgcagtggagccaggtgagc
gcggccctgctggaatccctcgagatggaccgactgcgcttcccggagatctacgaggag
cgggccgcccgctaccggctcgagccctaccggctgaagctgagctacaccctcgagcgg
ctgcgcctcacccagcagcgcaaccagcagctggccgaggcgggctgggaatccccctgc
gacgggtcctcgggctacgaggccggactgagcagcctgatggagccggccccaccccag
gaactccactacgcctcggtggaggaattccgcaccgacctggagctgatcaaggagagc
ctcgatgccacgggcctgagctgcgaagccctgcaggacctgctcagccaggtgcacatc
ttcgccttctccctggccagcctcgacatccgccaggagagcacccgccacagcgacgcc
atcgatgagctcagccgctacctgctgctgccggtgccctacggcgagatggacgaggag
cagcgggtggagtggctgctgagcgaactcaagacccgccggcccctgctgccgccggcg
gcccgctggagcgcccccaccgccgagaccttcgccgtgttccggatgctgcagcggctg
cagcaggagttcggccggcgcatctgccgcacctatgtgatctccatgagtcacacggtg
tcggacctgctggaggtggtgctgctggccaaggaggccgggctggtggatccgatggcc
cagaaatcggccctgctggtgatccccctgttcgaaacggtagaagacctgcagggggcc
ccggccgtgatggggcggctgttcgccgaccccttctaccgccagctgctgatcagcaac
agcgacggtgagcagcccctgcaggaggtgatgctgggctactccgacagcaacaaggat
tccggcttcctctccagcaactgggagatccaccgggcccagatcgccctgcagtcgctg
gccgatgcccatgacgtggccctgcgcatcttccacggccgcggcggctcggtgggccgg
ggcggcggccccgcctaccaggcgatcctggcccagcccagcggcaccctcaaagggcgc
atcaagatcaccgagcagggggaggtgctggcctccaagtactccctgccggaactggcc
ctctacaacctggaaacggtcaccaccgccgtgctccagaacagcatggtcagcaccccg
gtggacgacacccccacctggaacgtgctgatggagcggctggcggcccgctcccgcgac
cactaccgggccctggtgcacgacaaccccgacctggtggccttcttccagcaggtcaca
ccgatcgaggagatcagcaagctgcagatctccagccggccggcgcggcgcaagagcggc
gccaaggacctctccagcctgcgggccatcccctgggtgttcggctggacccagagccgt
ttcctgctgcccagctggtacggggtggggacggccctgcaggccgagctcgacgccgac
ggcgagcagatggagctgctgcagctgctctaccagcgctggcccttcttccgcatgctg
atctccaaggtggagatgaccctctccaaggtcgacctggagctggccggccattacgtc
acctccctgggacgcccccagaacagggaggtgttcgcccagatcttcgaggcgatcgcc
agtgagttcgccctcacccattccctggtgctgcgcatcagcaaccacagccggctgctg
gacggcgacccggccctgcagctgtcggtcgacctgcgcaaccgcacgatcatccccctg
ggctacctgcaggtggcgctgctgcgccggctgcgggagcagaaacggcagccccccatg
agtgaggggcccggcgacgggccgggaggcggcggcgacggccgcacctacagccgcagc
gaactgctccgcggcgccctgctcaccatcaacggcatcgccgccggcatgcgcaacacg
ggctga

DBGET integrated database retrieval system