KEGG   Cyanobium gracile: Cyagr_2398Help
Entry
Cyagr_2398        CDS       T02359                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
cgc  Cyanobium gracile
Pathway
cgc00250  Alanine, aspartate and glutamate metabolism
cgc00410  beta-Alanine metabolism
cgc00430  Taurine and hypotaurine metabolism
cgc00650  Butanoate metabolism
cgc01100  Metabolic pathways
cgc01110  Biosynthesis of secondary metabolites
cgc01120  Microbial metabolism in diverse environments
cgc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Cyagr_2398
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cyagr_2398
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Cyagr_2398
   00430 Taurine and hypotaurine metabolism
    Cyagr_2398
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Cyagr_2398
Enzymes [BR:cgc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Cyagr_2398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Hist_deacetyl
Motif
Other DBs
NCBI-ProteinID: AFY29504
UniProt: K9PA95
LinkDB All DBs
Position
complement(2324719..2326116)
Genome map
AA seq 465 aa AA seqDB search
MTLHDRAAAGYFLEDDISSSTDLSVTLPKNHFPSREHNPRAVFAAIRDELMLDGNSRQNL
ATFCLTWVEDEVHALMDLCIDKNIEDKDEYPQTAEIEARCARMVADLWHAPSVDDAIGCS
TTGSSEAAKLAGLAMKRRWGAQRKQQGQPSDRPNLVTGPLQICWHKFCRYWDIELREIPM
QPDQLILSPEAALRYCDENTIGVVPTLGVTFTGQYEPVQALAAALDGLQARTGLDIPIHV
DAASGGFLAPFCAPDLVWDFRLPRVRSINASGHKFGLAPLGVGWVLWRQSRDLPEEMVFW
VNYLGSNRRDLTLNFSRPGGQVVCQYYNFLRLGREGYRKVHAACYATAQYLARVIAKLGP
FEILFGGEDQAGIPALCWMKREGSAVNFNLYALADRLRVHGWQVPAYSLPAHCEGITVQR
ILVRHGVSRDLADLLLENIRQSLDVFASHPGHHALSEATASGFHH
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaccctccacgacagagcggcggccggatacttcctggaggacgacatctcttcatcc
accgatctctcggtcacgctgccgaagaaccatttccccagcagggagcacaacccccgc
gccgtgttcgccgcgatccgcgacgagctgatgctggatggcaattcccgtcagaacctg
gccaccttctgtctgacctgggtggaggacgaagtccatgccctgatggatctgtgcatc
gacaagaacatcgaggacaaggacgaatatccccagaccgccgagatcgaagcccgctgt
gcccgcatggtggccgatctctggcatgccccctcagttgatgacgccatcggctgctcc
accaccggctccagcgaggccgccaagctcgcggggctggcgatgaagcgccgctgggga
gcgcagcggaagcaacaagggcaacccagcgacagacccaacctggtgaccgggccgttg
cagatctgctggcacaagttctgccgctactgggacatcgagctccgggagatcccgatg
cagcccgaccagctgatcctcagcccggaagcggccctgcgctactgcgacgagaacacc
atcggcgtggtgcccaccctgggggtcaccttcaccggccagtacgagccggtgcaggcg
ctggcggccgccctcgatggcctgcaggcccgcaccggcctcgacatccccatccacgtg
gatgccgccagcggcggcttcctggcgcccttctgcgcccccgatctggtctgggacttc
cggctgccgcgggtgcgctcgatcaatgcctccggccacaagttcggcctggcgcccctg
ggggtgggctgggtgctgtggcggcagtcacgggatctgcccgaggagatggtgttctgg
gtgaactacctggggagcaacaggcgcgatctcaccctcaacttctcccggcccgggggc
caggtggtctgtcagtactacaactttctgcgcctgggccgggagggctaccgcaaggtg
cacgccgcctgttacgccaccgcccagtacctggcccgggtgatcgccaagctggggccg
ttcgagatcctgttcggcggcgaggatcaggcgggcattcccgccctctgctggatgaaa
cgggagggaagcgcggtgaacttcaacctctacgccctcgccgaccgcctgcgggtgcac
ggctggcaggtgccggcctacagcctgccggcccactgcgaggggatcaccgtgcagcgg
atcctggtgcgccatggcgtcagccgcgatctggccgatctcctgctggagaacatccgc
cagtcgctcgacgtcttcgccagccaccccggccaccacgccctcagcgaggcgacggcc
tcggggttccaccactga

DBGET integrated database retrieval system