KEGG   Cupriavidus gilardii: CR3_1409Help
Entry
CR3_1409          CDS       T04050                                 

Gene name
aldB
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
cgd  Cupriavidus gilardii
Pathway
cgd00010  Glycolysis / Gluconeogenesis
cgd01100  Metabolic pathways
cgd01110  Biosynthesis of secondary metabolites
cgd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CR3_1409 (aldB)
   00620 Pyruvate metabolism
    CR3_1409 (aldB)
Enzymes [BR:cgd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     CR3_1409 (aldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ALD90641
UniProt: A0A0M4LFU3
LinkDB All DBs
Position
1:1684351..1685871
Genome map
AA seq 506 aa AA seqDB search
MNHAELKFLDIEFPYKASYDNFIGGKWVPPQSGQYFDNVSPVTGQAFCKIARSNADDIEL
ALDAAYAAKAAWARTSPAERANVLNRIADRMEANLQRLAVAETIDNGKPLRETMAADLPL
AIDHFRYFAGAVRAQEGGISEIDHDTIAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALA
AGNCVVLKPAEQTPASIMVLLEIIGDLLPPGVLNVVNGFGLEAGKPLASNKRIAKIAFTG
ETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVLDKDDAFFDKALEGFAMFALNQGEV
CTCPSRALIQESVYDRFMERAIKRVEAIKQGHPLDRSTMIGAQASQEQLEKILSYIDLGK
QEGAQLLTGGERAQLGNGLENGYYVKPTVFRGHNKMRIFQEEIFGPVVSVTTFKTEEEAL
EIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGREN
HKMMLDHYQQTKNLLVSYSPNALGFF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatgcggaactgaagttcctcgatatcgaattcccgtacaaggcgtcctacgac
aacttcatcggtggcaagtgggtaccgccgcagtcgggccagtacttcgacaacgtgtcg
ccggtcacgggacaagccttctgcaagatcgcgcgttccaacgccgacgatatcgagctg
gcgctcgacgcggcctacgccgccaaggccgcctgggcccgcacgtcgcccgccgagcgc
gccaatgtgctgaaccgcattgccgaccgcatggaggccaacctgcagcgcctggcggtc
gccgagacgatcgacaacggcaagccgctgcgcgagaccatggccgccgacctgccgctg
gcgatcgatcatttccgctatttcgccggcgcggtgcgcgcgcaggaaggcggcatctcg
gagatcgaccacgacaccatcgcctaccacttccatgagccgctgggcgtagtcggccag
atcatcccgtggaatttcccgctgctgatggcgacgtggaagctggcccccgcgctggcc
gccggcaactgcgtggtgctcaagcccgccgagcagaccccggcctcgatcatggtgctg
ctcgaaatcatcggcgacctgctgccgcccggcgtgctcaacgtcgtcaacggcttcggc
ctggaagcgggcaagccgctcgcgtcgaacaagcgcatcgccaagatcgccttcaccggc
gagaccactaccggccggctgatcatgcagtacgccagccagaacctgattccggtcacg
ctggagctcggcggcaagagcccgaacatcttcttcgccgacgtgctcgacaaggacgac
gcgttcttcgacaaggcgctggaaggcttcgcgatgttcgcgctgaaccagggcgaggtc
tgtacctgcccgtcgcgggcgctgatccaggagtcggtctacgaccgcttcatggagcgg
gccatcaagcgcgtcgaggcgatcaagcaaggccatccgctggaccgcagcacgatgatc
ggcgcgcaggcctcgcaggagcagctcgagaagatcctgtcgtacatcgacctgggcaag
caggaaggcgcgcaactgctgacgggcggcgaacgcgcccagctgggcaacgggctggag
aacggctactacgtcaagccgaccgtgttccgcggccacaacaagatgcgcatcttccag
gaggagatcttcgggccggtggtatcggtgacgaccttcaagaccgaggaagaagcgctc
gagatcgccaacgacacgctgtatggccttggcgccggggtctggacgcgcgacggcacg
cgggcctaccgtttcggccgcgcaatccaggccggacgcgtgtggaccaactgctatcac
gcctaccccgcgcacgcggcgttcggcggctacaagcaatcgggcatcgggcgcgagaac
cacaagatgatgctcgaccactatcagcagaccaagaacctgctggtcagctacagcccc
aacgcgctcggcttcttctga

DBGET integrated database retrieval system