KEGG   Cupriavidus gilardii: CR3_1451Help
Entry
CR3_1451          CDS       T04050                                 

Gene name
ftsK
Definition
(GenBank) cell division protein FtsK
  KO
K03466  DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family
Organism
cgd  Cupriavidus gilardii
Brite
KEGG Orthology (KO) [BR:cgd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cgd03036]
    CR3_1451 (ftsK)
Chromosome and associated proteins [BR:cgd03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    CR3_1451 (ftsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FtsK_SpoIIIE FtsK_alpha FtsK_gamma FtsK_4TM AAA_10 DUF87 TrwB_AAD_bind T2SSE DEAD AAA_22 AAA_29 DUF815
Motif
Other DBs
NCBI-ProteinID: ALD90683
UniProt: A0A0M4L391
LinkDB All DBs
Position
1:complement(1732126..1735266)
Genome map
AA seq 1046 aa AA seqDB search
MGLGWFGLSTFWLLPLAWRMVARMLAGQPVFSGPGTLRVWLGSALTLCASAALEALTAST
SASSDVEPTASSGGAAGAGVAGIAADLFGWTGALLLMLGVLALAAPMVFGETWPSLFARK
PRRHAAAGDPGDAAAPPVSRPVREASMPAPAATRWTPVADDSARRPTARHKGIEAVSARR
APAWQPPPRTRVSPPQPGEIWLHPTQPTRTVAPARPAATAPAQKPAPARTAASAPSRPTA
AAASTPAAPASSRTPLRATVVASPFHQPQLGLRSAITTLPEAQPLAKAASAVPANGGNVA
TASPTTTAAEQGTAAPIADVATAAAMAEAMAGPAEPYPAEAEPAQAEQSAAYEAIRAEAQ
ALLAELRALAGAEQDQLDSEHTADTLPGDPAEAHDIAVPAVPEAAPTQPDAATPTVALPP
ALEAGPNAELASGPNPEPNVEPNAEPPPVAMPAPAWEPPWQESPADIAAASAASSAAASA
VTVQAASELAPAATSETTGPTPAPAQKPRIVLPAVVGRAVPLDAAAPPASTVVAAKPAVP
AQPVVPPPPRIVDYRLPGIDLLEPAVEHAEQVSEQHLAETGELIAQRLAEFKVPVSVVGA
SAGPVITRFEVEPAMGVRGAQVVGLMKDLARALGVSSIRVVETIPGKTCMGLELPNARRE
MIRLSEIVAASSFQAHASRLVLAMGKDITGNPVVTDLARAPHLLVAGTTGSGKSVAINAM
ILSMLYKATPDDVRMIMIDPKMLELSVYEGIPHLLAPVVTDMKQAAHALNWCVGEMEKRY
RLMSALGVRNLAGYNQKIRAAEAAGDKVRNPFSLTPDAPEPLSTLPLIVVVIDELADLMM
VAGKKIEELIARLAQKARAAGIHLILATQRPSVDVITGLIKANIPTRVAFQVSSKIDSRT
ILDQMGAESLLGQGDMLFLPPGTGYPQRVHGAFAGDDEVHRVVEHWKQFGEPDYDDAILA
PDPAEAGGGDLFGDGPGGDAEADPLYDEAAAFVLTSRRASISAVQRHLRIGYNRAARLIE
QMEVAGLVSPMGRNGARDVLAPGGQE
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgggtttgggctggttcggattgtcgaccttctggctattgccgctggcgtggcgcatg
gtggcgcgcatgctggcggggcagccggtgttttccgggcccggcacgctgcgcgtctgg
ctgggcagtgcgctgacgctgtgcgcgagcgcggcgctcgaagcgctgactgccagtacg
tcggcctcgtccgacgtggagcccaccgcgtcctccggcggtgccgcgggggcaggggtg
gccggcatcgcggccgatctgttcggctggaccggcgcgctgctgctgatgctgggtgtg
ctggcgctggccgcgccgatggtgttcggcgagacctggcccagcctgttcgcgcgcaag
ccgcggcgccatgccgctgccggcgatccgggcgacgcagcggcacccccggtctcgcgg
cccgtgcgcgaagcttccatgccggcccctgcggcaacgcgatggacgccggtggcagac
gacagcgcccggcggccgaccgcccgccacaagggcatcgaagcggtatccgcgcgccgg
gcgcccgcgtggcaaccgccgccgcgaacccgcgtatcgccgccacagcccggcgaaatc
tggctgcatccgacgcaaccgacccggaccgttgcaccggcgcggcccgcggcaacggcg
cctgcgcagaagcccgcgccggccaggaccgccgcttcggcaccatcgcggccgacggcc
gccgcggcatcgacccctgccgcccccgcgtcctcgcgcacgccattgcgcgcgaccgtt
gtcgccagccccttccatcagccgcaactgggtttgcgcagcgcgatcacgacgttgccc
gaagcgcagccgctggcgaaggcggcgagcgctgtgccggcgaatggcggcaacgtagcg
acggcttccccgacgacgacggccgcggagcagggcaccgccgcgccgatcgctgacgtg
gccacagccgcggccatggccgaagcgatggccgggccggccgaaccttatccggccgaa
gccgagccagcgcaggccgagcagagcgcggcctacgaggcgatccgcgccgaggcacag
gcgctgcttgccgaattgcgcgccctggctggtgccgaacaggaccagctggacagcgag
cacacggccgacaccctgccgggcgatccggccgaagcgcacgacatcgcggtccccgct
gtccccgaggctgcgccgacgcagcccgatgccgcgacgccgaccgtggcattgccgccg
gccctcgaagccgggcccaatgccgagctggcttccgggccgaatcccgagccgaatgtg
gagccgaatgcggagcccccaccagtggcgatgcccgcgccagcctgggaaccaccgtgg
caagaatcgccggcggatatcgccgcagcttcggcagcgtcctcagcggccgcgtccgcc
gtcacggtgcaagccgcatccgaactcgcgcccgcagcaacatccgagacgaccgggccc
acgccggcccccgcgcagaagccccgcatcgtgctgccggccgtggtcggccgcgcggtg
ccgctggacgccgcagcgccgcccgcgagcaccgtcgtcgcggcgaagccggccgtaccc
gctcagccggtcgtcccgccgccgccccgcatcgtcgactatcgcctgccgggcatcgat
ctgctggagccggccgtcgaacacgccgagcaggtctccgaacagcatctggccgagacc
ggcgagctgatcgcgcagcggttggccgagttcaaggtgccggtgtccgtggtcggcgcg
tcggccggtccggtcatcacgcgcttcgaggtcgagcccgcgatgggcgtgcgcggggcg
caggtggtcgggctgatgaaggatctggcgcgcgcgctcggcgtcagttcgatccgcgtg
gtcgaaacgattcccggcaagacctgcatgggcctcgaattgcccaatgcccgccgcgag
atgatccgcctgtcggagatcgtcgcggcctcatcgttccaggcccatgcctcgcggctg
gtgctggcgatgggcaaggacatcaccggcaatccggtggtcaccgatctggcgcgcgcg
ccccacctgctggtggccggcaccaccggctcgggcaagtcggtggcgatcaacgcgatg
atcctgtcgatgctgtacaaggccacgccggacgatgtgcggatgatcatgatcgacccg
aagatgctggagctgtcggtctacgagggcatcccgcatctgctggcgccggtggtcacc
gacatgaagcaggccgcgcacgcgctgaactggtgcgtcggcgagatggagaagcgctac
cgcctgatgtcggcgctcggcgtgcgcaacctggccggctacaaccagaagatccgcgct
gccgaggccgccggcgacaaggtccgcaatccgttctcgctgaccccggacgcgcccgag
ccgctgtcgacgctgccgctgatcgtggtggtgatcgacgagctggccgacctgatgatg
gtggccggcaagaagatcgaggagctgatcgcgcgcctcgcgcagaaggcgcgcgcggcc
ggcatccatctgatcctggccacgcagcgcccgtcggtcgacgtgatcaccgggctgatc
aaggccaatatcccgacgcgcgtggccttccaggtctcgtcgaagatcgactcgcgcacg
atcctggaccagatgggcgccgaaagcctgctggggcagggcgacatgctgttcctgccg
ccgggcaccggctatccgcaacgcgtgcacggcgcctttgccggcgacgacgaagtccat
cgcgtggtcgagcactggaagcagttcggcgaacccgattacgacgacgcgatcctggcg
cccgatccggccgaggccggcggcggcgatctgttcggcgacgggcccggcggcgatgcc
gaggccgatccgctgtacgacgaggccgcggccttcgtgctgacctcgcgccgcgcctcg
atctccgcggtccagcgccatctgcgcatcggctacaaccgtgcggcgcggctgatcgaa
cagatggaggtggcgggactggtttcgccgatggggcgcaatggggcgcgggatgtgctc
gcgcctggggggcaggagtag

DBGET integrated database retrieval system