KEGG   Cupriavidus gilardii: CR3_3229Help
Entry
CR3_3229          CDS       T04050                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
cgd  Cupriavidus gilardii
Pathway
cgd00650  Butanoate metabolism
cgd01100  Metabolic pathways
cgd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CR3_3229 (puuE)
   00650 Butanoate metabolism
    CR3_3229 (puuE)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CR3_3229 (puuE)
   00280 Valine, leucine and isoleucine degradation
    CR3_3229 (puuE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CR3_3229 (puuE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cgd01007]
    CR3_3229 (puuE)
Enzymes [BR:cgd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CR3_3229 (puuE)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CR3_3229 (puuE)
Amino acid related enzymes [BR:cgd01007]
 Aminotransferase (transaminase)
  Class III
   CR3_3229 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALD92417
UniProt: A0A0M4KXD5
LinkDB All DBs
Position
2:351171..352445
Genome map
AA seq 424 aa AA seqDB search
MENTMKNAELVRRKDAATPRGVGVMCNFYAERAENSEIWDVEGRRFIDFAAGIAVLNTGH
RHPRLVAAVQKQLERFTHTAYQIVPYASYIELAEKINQRAPGQWAKKTAFFTTGAEAVEN
AIKIARSATGRPAVIAFSGGFHGRTMMGMALTGKVVPYKVGFGPFPGEVYHAPYPCELHG
VSVDDSLKALQVLFKADVDPKRVAAIIFEPVQGEGGFNVAPAAFVKALRALCDEHGILLI
ADEVQTGFGRTGKLFAMEHYGVAPDLTTMAKSLAGGMPLSAVCGRAEIMDAPAPGGLGGT
YAGNPLAVASALAVLEVLEEENLIARGAALGQRLMDRLHSLRPRVPQIAQVRGLGAMVAV
EFQQADGSPDAEFTREVQNRALQKGLLLLSCGVHGNVIRFLFPLTIPDAVMDEGLDILAD
VLAR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggagaacacgatgaagaatgccgaactggtccgccgcaaggatgccgccacgccccgc
ggcgtgggcgtgatgtgcaatttctacgccgaacgggccgagaattcggagatctgggat
gtcgaaggccgccgttttatcgacttcgcggccggcatcgcggtgctgaacaccggccac
cgccacccgcggctggtggcagccgtgcagaagcagctggaacggttcacccataccgct
taccagatcgtgccctatgccagctatatcgaactcgccgagaagatcaaccagcgcgcg
ccgggccagtgggccaagaagaccgcgttcttcaccaccggcgccgaggcggtcgagaac
gccatcaagatcgcccgctccgccaccgggcgacccgcggtgatcgcattttccggcggc
tttcatggccgcacgatgatgggcatggcgctgaccggcaaggtcgtgccctacaaggtc
ggcttcggtccgttcccgggcgaggtctatcacgcgccttacccatgcgagctgcacggc
gtgtcggtcgacgactcgctgaaggcgctgcaagtcctgttcaaggccgacgtcgatccg
aaacgggtcgccgccatcatcttcgagccggtgcagggcgagggcggcttcaatgtcgcg
cccgccgccttcgtcaaggcgctgcgcgcgctctgcgacgagcacggcatcctgctgatc
gccgacgaagtgcagaccggtttcggccgcaccggcaagctgtttgcgatggagcattac
ggcgtggcgccggatctgaccacgatggccaagagcctggccggcggcatgccgctgtcg
gcggtgtgtggccgcgccgagatcatggacgcgccggcgccgggcgggctcggcggcacc
tatgcaggcaatccgctggccgtcgcctcggccctggcggtgctcgaggtgctggaagag
gagaacctgatcgcgcgcggcgccgccctcggccagcggctgatggaccggctgcacagc
ctgcgcccgcgcgtgccgcagatcgcgcaagtgcgagggctcggcgcgatggtcgcggtg
gagttccagcaggccgacggcagtcccgatgccgagttcacgcgcgaggtacagaaccgc
gcgctgcagaagggcctgctgctgctgtcgtgcggcgtgcacggcaacgtgatccgcttc
ctgttcccgctgaccattcccgatgcggtgatggacgaagggctggacatcctggccgac
gtgctggcccgctga

DBGET integrated database retrieval system