KEGG   Cupriavidus gilardii: CR3_4210Help
Entry
CR3_4210          CDS       T04050                                 

Gene name
treS
Definition
(GenBank) maltose alpha-D-glucosyltransferase/alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
cgd  Cupriavidus gilardii
Pathway
cgd00500  Starch and sucrose metabolism
cgd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cgd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CR3_4210 (treS)
Enzymes [BR:cgd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CR3_4210 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CR3_4210 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap DUF3459
Motif
Other DBs
NCBI-ProteinID: ALD93392
UniProt: A0A0M4KZ27
LinkDB All DBs
Position
2:1592523..1596287
Genome map
AA seq 1254 aa AA seqDB search
MKRLSERGSTALLNADPLWYKDAVIYQLHIKSFYDANGDGVGDFAGLLAKLDYLVSLGVD
TIWLLPFYPSPRRDDGYDIADYRNVHPEYGTLAEARRFIAAAHARGLRVITELVINHTSD
QHPWFQRARHAKPGSAARNYYVWSDTDQAYSGTRIIFCDTEKSNWSWDPVAGAYFWHRFY
SHQPDLNFDNPLVLRDVLSVMRFWLDMGIDGLRLDAVPYLVEREGTSNENLPETHAVIRQ
IRKHLDDHYQGRLLLAEANMWPEDAQQYFGGAPATGERPAHGDECHMAFHFPLMPRMYMA
IAREDRFPITDIIRQTPEIPPNCQWAIFLRNHDELTLEMVTSSERDYLWEVYASDRRARI
NLGIRRRLAPLMERDRRRIELMNSLLFSMPGTPVIYYGDEIGMGDNIHLGDRDGVRTPMQ
WSPDRNGGFSHADPERLVLPPLQGPLYGYEAVNVEAQSRDTHSLLNWMRRMLALRRQHRA
FGRGSFRFLFPGNRKILAYLREYEGEHILCVANLSRAPQAVELDLSEFEGRVPVEMLGAT
PFPAIGQLTYLLTLPPYGFYWFVLSTEAQPPSWHVDAPQQMPELITLIMQNTAQADLTEA
SRRILSNEVLPDYIARRRWFGAKSEKIQGVTIAYAVPFGAAAPGEAIYLSEVEVALQGRS
ECYQLPVSVLWDHDAPGASVPQLAHGLAMARVRRGSRVGLATDGFVVERFAREVVKALRA
GTEIATPHGQIHFRGGPGLAALALEDDPVQWMSAEQSNSSLSFNNSAVLKLVRRVSGGIH
PEAEMTRYLTEQGYANAAALLGEVVRTGADGTPHTLMLLQGYILNQGDGWNWTLDYIGRA
IDDALPMENENGDDEFTEAMHGFAAMAATLGRRLAELHAVLARPSEDEAFAPVPAGEAQV
REWTDDAMAALNTALQLMSAGAGQPPQGAIGERYRADVQAVLDSRERLPELVAALAAAAP
GSLQTRIHGDLHLGQVLIAQNDTYIIDFEGEPGLPLAYRRRKTSPLRDVAGILRSFDYAA
ATVGTDRSERTHSTLPPAQAERREGLLERFRQTATEAFLGGYREVAETALHPWAAPGQMQ
PLLDLFLLERAAYEVKYEADNRVTWIDLPVHGLARLIRTLTGAPAGTAAPRRPRRLPPLT
SETQSWPRRLFPAPRRRGARTGNRNTPPPSSTPCWARGMPIRFRCSARTGRASGWWCVPA
CPARSRSRWPTTQATRSVRCNASTPAASSPARCPTSWAAAITGSISPGATAPAS
NT seq 3765 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcctctccgagcgcggcagcaccgcgctgctgaacgccgatccgctgtggtac
aaggacgcggtcatctaccagctgcacatcaagtcgttctacgacgccaatggcgacggg
gtcggcgacttcgccgggctgctggcgaagctcgactacctggtcagcctcggcgtcgac
acgatctggctgctgcccttctatccgtcgccgcgccgcgacgacggctacgacatcgcg
gactaccgcaatgtccacccggaatacggcacgctggccgaggcgcggcgcttcatcgcg
gcggcgcatgcgcgcgggctgcgcgtgatcaccgagctggtgatcaaccatacctccgac
cagcatccgtggttccagcgcgcgcgccatgccaagccaggctcggccgcgcgcaattac
tacgtctggtccgacaccgaccaggcctacagcggcacgcgcatcatcttctgcgatacc
gagaagtcgaactggagctgggacccggtggccggggcctatttctggcaccgcttctat
tcgcaccagccggacctgaacttcgacaatccgctggtcttgcgcgacgtgctgtcggtg
atgcggttctggctcgatatgggcatcgacgggctgcggctcgacgccgtgccctatctg
gtcgagcgggagggcaccagcaacgagaacctgcccgagacccatgcggtgatccgccag
atccgcaagcatctggacgaccactaccaggggcggctgctgctggccgaggccaatatg
tggcccgaggacgcgcagcagtacttcggcggcgcgccggccaccggcgagcggcccgcg
cacggcgacgaatgccacatggcgttccacttcccgctgatgccgcgcatgtacatggcg
atcgcgcgggaggaccgctttccgatcaccgacatcatccgccagacgccggaaattccg
ccgaactgccagtgggcaatcttcctgcgcaaccatgacgagctgacgctggagatggtg
accagcagcgagcgcgactatctgtgggaggtctatgcgtcggaccgccgcgcgcgcatc
aacctgggcatccgccgccggctggcgccgctgatggagcgcgaccggcgccgcatcgag
ctgatgaacagcctgctgttctcgatgcccggcacgccggtgatctactacggcgacgag
atcggcatgggcgacaacatccacctgggcgaccgcgacggcgtgcgcacgccgatgcag
tggtcgccggaccgcaacggcggcttctcgcatgccgatcccgagcggctggtgctgccg
ccgctgcagggcccgctgtatggctacgaagccgtcaatgtcgaggcgcagtcgcgcgac
acccattcgctgctcaactggatgcgccgcatgctggcgctgcggcgccagcaccgggcg
ttcggccgcggcagcttccgcttcctgttccccggcaaccgcaagatcctggcctatctg
cgcgaatacgagggcgagcacattctttgcgtggccaatctgtcgcgcgcgccgcaggcc
gtcgagctggacctgtccgagttcgagggccgggtgcccgtcgagatgctcggcgcgacc
ccgttcccggcaatcggccagctgacctatctgctgacgctgccgccctatggcttctac
tggttcgtgctgtccaccgaggcgcagccgccgtcctggcacgtcgacgcgccgcagcag
atgcccgagctgatcacgctgatcatgcaaaacaccgcgcaagccgacctgaccgaagcg
tcgcgtcgcatcctgtcgaacgaggtactgcccgattacatcgcgcggcgccgctggttc
ggcgccaagagcgagaagatccagggcgtcaccattgcctatgcggtgccgttcggcgcc
gccgcgcccggcgaagcgatctatctgtccgaggtcgaggtcgcgctgcaggggcgcagc
gagtgctaccagctgccggtcagcgtgctgtgggaccacgacgcgcccggcgcgagcgtg
ccgcaactggcgcacgggctcgcgatggcgcgcgtgcgccgcggcagccgggtcggcctt
gcgaccgacggcttcgtggtcgaacgcttcgcccgcgaggtcgtcaaggcgctgcgcgcc
ggcaccgagatcgccacgccgcacgggcagatccacttccggggcggcccgggcctggcg
gcgctggcgctggaagacgatccggtccagtggatgtcggcggagcaatcgaacagttcc
ctgtcgttcaacaactcggcggtgctcaagctggtgcggcgcgtctccggcggcatccat
ccggaagccgagatgacgcgctatctgaccgagcagggctatgccaacgccgccgcgctg
ctcggcgaagtggtgcgcaccggcgccgacggtacgccgcatacgctgatgctgctgcag
ggctacatcctgaaccagggcgacggctggaactggacgctcgactatatcggccgcgcg
atcgacgatgcgctgccgatggagaacgagaacggcgacgacgagttcaccgaagcgatg
catggcttcgcggcgatggcggcgacgctgggccggcgcctggccgagctgcacgcggtg
ctggcgcggcccagcgaagacgaggccttcgcgccggtgccggccggcgaggcgcaggta
cgggagtggaccgacgatgcgatggccgcgctgaacaccgcgctgcagctgatgagcgcc
ggcgccggccagccgccgcagggcgcgatcggcgagcgctaccgcgccgacgtgcaggcg
gtgctcgacagccgcgaacggttgcccgagctggtcgccgcgctggccgcggcggcaccg
ggcagcctgcagacgcgtattcacggcgacctgcacctgggccaggtgctgatcgcgcag
aacgacacctacatcatcgacttcgagggcgagccgggcctgccgctggcctaccgccgc
cgcaagacgtcgccgttgcgcgacgtggccggcatcctgcgctcgttcgactatgccgcc
gcgacggtcggcaccgaccgcagcgagcgcacgcattcgacgctgccgcctgcgcaggcg
gagcggcgcgaaggcctgctcgagcgcttccgccagaccgccaccgaggccttcctcggc
ggctaccgcgaggtggccgagaccgcgctgcacccgtgggccgctcccggccagatgcag
ccgctgctcgacctgttcctgctcgagcgcgccgcctacgaggtcaagtacgaggccgac
aatcgggtcacctggatcgacctgccggtgcacggactggcgcggctgatccgcacgctg
accggcgcgcccgccggcacggccgcgccccgccggcctcgccgcctcccgcccctcacg
tctgagacgcaatcatggccacgacgactttttccggccccgcgtcgacgcggggcccgc
acgggcaatcggaacacaccgccgcccagttcgacgccctgctgggcgcgcggcatgccg
atccgttttcgctgctcggcccgcaccgggagggcgagcggatggtggtgcgtgcctgcc
tgcccggcgcgcagtcggtcgcgctggccgacaacgcaggcaacgcgatcggtccgatgc
aatgcatccacgccggcggcatcttcgccggcacgctgcccgacaagctgggccgccgcg
attaccggctcgatatcacctggggcgacggcacccgccagctga

DBGET integrated database retrieval system