KEGG   Cupriavidus gilardii: CR3_4453Help
Entry
CR3_4453          CDS       T04050                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cgd  Cupriavidus gilardii
Pathway
cgd03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cgd00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    CR3_4453
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cgd03400]
    CR3_4453
Enzymes [BR:cgd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CR3_4453
DNA repair and recombination proteins [BR:cgd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CR3_4453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ALD93632
UniProt: A0A0M4KNS6
LinkDB All DBs
Position
2:1876302..1879256
Genome map
AA seq 984 aa AA seqDB search
MATKRAAKQPAKAAAKRTGKQTPAAAAKGAATRSTSRAAARPAAPRAARGANPDPLQRYR
TMRDFGTTAEPAGRAVAQRAAAKTAEALSFVVQKHAARRLHYDFRLELDGTLKSWAIPKG
PSLDPADKRMSVHVEDHPLEYANFEGVIPERQYGAGTVIVWDRGTWVPIGDPHQGYRDGK
LKFELQGEKLHGAWTLVRMRGRDERQEPWLLIKERDDAARPAAEFDITEAMPDSVLGGGT
PSADDEGARKASAKSATSTAARKAPRTAAKAATGSASGKGAAAGKSAGKTAGKGRSAAGA
IQLPSAARRAALPLTLAPQLATLVQGPPVDAQNWIYELKFDGYRVLARIEGSDVKLFTRN
GHDWTSKLKTLARELGTLNLPSAWLDGEIVIVDKDGSTDFQALQNAFDSERTDAIQFFVF
DIPFYAGHDLRQVALVERRDLLRRLFEEHNVSAHLRFSESFEAGPEEILSAACRLRLEGL
IGKRVDAPYVSARSPNWIKLKCSERQEFVIGGFTEPKGTRNGLGALLLGIHDESGRLIYA
GKVGTGFDTKTLDTIRAKLDALRTDASPFDKMPAIAKGVKGIWVRPKAVAEVSFGSWTRD
GLIRHAVFHGLRSDKSASAIGKEKAMPAPGKSVGEAKAAATARKGKKDKAGDKPAESARK
AAHADRAESADTPPSDKPAAATKSSSGRQQIGNVRVSHADRVIDPSTGATKGDLVRYYEA
VAPRMLPELRGRPLAVLRGPSGVGGELFFQKHAETFNIAGVNRLDPSLWPGHPPMIEVAS
ETGIVAAAQLNVIEFHTWNADKRQIEKPDRVIFDLDPGAGVPWKHVVEAAALTKGMLDEL
ELTAFLKTSGGKGLHVVVPIARRLGWDEVKDFAQALVVHMAKTIPQRFVSKSGPRNRVGK
IFIDYLRNGRGATTVAAFSARARPGLGVSIPCSWDELPALRSGAQWTIANALARIEETEH
ADPWADYGSTRQTLTAAIRRLGNG
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaaagcgagcagcaaagcagccggccaaggccgcagcgaagcgaaccggcaag
cagacccctgcagccgcggccaaaggcgcggccacacggtcgacgtcgcgcgccgccgcg
cgtccggcggcaccgcgcgcggcgcgaggcgcgaatcccgacccgctgcagcgctatcgc
acgatgcgcgactttggcacgacggcggaaccggccggccgcgcggtcgcccagcgtgcc
gcggcgaaaaccgccgaagcgctgtcgttcgtcgtgcagaaacacgcggcgcgccgcctg
cactacgacttccgcctcgaactcgacggcacgctcaagagctgggccattccgaagggt
ccaagcctggacccggccgacaaacggatgagcgtccacgtcgaggaccacccgctcgaa
tatgcgaacttcgaaggcgtgatccctgaaaggcagtacggcgccggcaccgtgatcgtc
tgggaccgcggcacctgggtaccgatcggcgatccgcatcagggctatcgcgacggcaag
ctgaagttcgagctgcagggcgagaagctgcatggcgcctggacgctggtacggatgcgg
ggccgggacgaacggcaggaaccgtggctgctgatcaaggagcgcgacgatgcggcgcgg
ccggcggcggagttcgacatcaccgaggcgatgccggacagcgtgctcgggggtggcacg
ccgagcgccgacgacgagggcgcgcgcaaggcatcggcgaagagcgcgaccagcaccgcg
gccaggaaggcgccgcggacggcggcgaaagccgcgacaggatcggcttcgggcaagggg
gcggcagctgggaagagcgccggcaagacggccggcaaaggccggtccgccgccggcgca
atccaactgccgagcgccgcgaggcgcgcggcgctgccgctgacgctggcgccgcaactg
gcgacgctggtgcaaggcccgcccgtcgatgcgcagaactggatctacgagctcaagttc
gacggctatcgcgtgctggcccgcatcgagggcagcgacgtcaagctgttcacgcgcaac
gggcacgactggacatcgaagctgaagacgctggcgcgcgagctcggcacgctgaacctg
ccatcggcgtggctggacggcgagatcgtcatcgtcgacaaggacggcagcaccgatttc
caggcgttgcagaacgccttcgacagcgagcgcaccgatgcgatccagttcttcgtgttc
gacatccctttctatgccggccacgatctgcgccaggtcgcgctggtcgagcgccgcgac
ctgctgcgacgactcttcgaagaacacaacgtgtcggcgcacctgcgtttcagcgagagc
ttcgaagccggccccgaggagattctcagcgcggcctgccggctgcggctcgaggggctg
atcggcaagcgtgtcgatgcgccgtacgtgtccgcgcgctcgccgaactggatcaagctc
aaatgcagcgaacggcaggagttcgtgatcggcggcttcaccgagcccaagggcacgcgc
aacggcctgggcgcgctgctgctgggcatccacgacgaatcgggccggttgatctatgcc
ggcaaggtcggcaccggcttcgacacgaagacgctcgatacgatccgcgccaagctcgat
gccctgcgcaccgatgcctccccgttcgacaagatgccggcaatcgccaaaggcgtgaag
ggcatctgggttcggccgaaggcggtcgccgaggtgtcgttcggctcgtggacgcgcgac
gggctgatccgccatgcggtgttccatggcttgcggtcggacaagagcgccagcgcgatc
ggcaaggaaaaggcgatgccggcccccggcaagagcgtgggcgaggcgaaagccgcggcg
acagcgcgcaaggggaagaaggacaaggccggcgacaaaccggcggagtccgccaggaag
gcggcccacgccgaccgggctgagagcgccgatacgccgccgtcggacaaacccgctgca
gcgacgaagtcctcctccggccgccagcagatcggcaacgttcgcgtcagccatgccgat
cgcgtcatcgatccgtcgaccggcgcgaccaagggcgacctggtgcgctactacgaagcg
gtcgcgccccgcatgctgccggaattgcgcggccgcccgctggcggtgctgcgtggcccg
tccggcgtcggcggcgagctgttcttccagaagcatgccgagaccttcaacatcgccggc
gtcaatcggctcgatccgtcgctgtggccgggccacccgccgatgatcgaggtcgccagc
gagaccggcatcgtcgccgcggcgcagctcaacgtgatcgagttccatacgtggaacgcc
gacaagcgccagatcgaaaagcccgatcgcgtgatcttcgacctggaccccggcgcgggc
gtgccctggaagcatgtggtcgaggcggccgcgctgaccaagggcatgctcgacgagctc
gagctgacggcgttcctgaagaccagcggcggcaagggcctgcacgtggtggtgccgatc
gcgcgccggctcggctgggacgaggtcaaggactttgcccaggcgctggtcgtccatatg
gcgaagaccatcccgcagcgcttcgtctccaagagcgggccgcgcaaccgcgtcggcaag
attttcatcgactacctgcgcaacgggcgcggcgccaccacggtggccgcgttctcggcg
cgcgcccggccgggcctgggcgtgtcgatcccctgcagctgggacgagctgccagcgctg
cgctcgggcgcgcaatggacgatcgccaacgcgctggcgcgcatcgaagagaccgagcat
gccgatccctgggcggactacggcagcacgcgccagacgctgaccgccgccatccggcgc
ctcggcaacggctga

DBGET integrated database retrieval system