Cricetulus griseus (Chinese hamster): 100682525 Help Entry 100682525         CDS       T02813                                  Gene name Tp53 Definition (RefSeq) cellular tumor antigen p53   KO K04451   tumor protein p53 Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge01522   Endocrine resistance cge01524   Platinum drug resistance cge04010   MAPK signaling pathway cge04071   Sphingolipid signaling pathway cge04110   Cell cycle cge04115   p53 signaling pathway cge04137   Mitophagy - animal cge04151   PI3K-Akt signaling pathway cge04210   Apoptosis cge04211   Longevity regulating pathway cge04216   Ferroptosis cge04218   Cellular senescence cge04310   Wnt signaling pathway cge04722   Neurotrophin signaling pathway cge04919   Thyroid hormone signaling pathway cge05012   Parkinson disease cge05014   Amyotrophic lateral sclerosis cge05016   Huntington disease cge05160   Hepatitis C cge05161   Hepatitis B cge05162   Measles cge05163   Human cytomegalovirus infection cge05165   Human papillomavirus infection cge05166   Human T-cell leukemia virus 1 infection cge05167   Kaposi sarcoma-associated herpesvirus infection cge05168   Herpes simplex virus 1 infection cge05169   Epstein-Barr virus infection cge05200   Pathways in cancer cge05202   Transcriptional misregulation in cancer cge05203   Viral carcinogenesis cge05205   Proteoglycans in cancer cge05206   MicroRNAs in cancer cge05210   Colorectal cancer cge05212   Pancreatic cancer cge05213   Endometrial cancer cge05214   Glioma cge05215   Prostate cancer cge05216   Thyroid cancer cge05217   Basal cell carcinoma cge05218   Melanoma cge05219   Bladder cancer cge05220   Chronic myeloid leukemia cge05222   Small cell lung cancer cge05223   Non-small cell lung cancer cge05224   Breast cancer cge05225   Hepatocellular carcinoma cge05226   Gastric cancer cge05230   Central carbon metabolism in cancer cge05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100682525 (Tp53)    04310 Wnt signaling pathway     100682525 (Tp53)    04071 Sphingolipid signaling pathway     100682525 (Tp53)    04151 PI3K-Akt signaling pathway     100682525 (Tp53)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     100682525 (Tp53)   09143 Cell growth and death    04110 Cell cycle     100682525 (Tp53)    04210 Apoptosis     100682525 (Tp53)    04216 Ferroptosis     100682525 (Tp53)    04115 p53 signaling pathway     100682525 (Tp53)    04218 Cellular senescence     100682525 (Tp53)  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     100682525 (Tp53)   09156 Nervous system    04722 Neurotrophin signaling pathway     100682525 (Tp53)   09149 Aging    04211 Longevity regulating pathway     100682525 (Tp53)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100682525 (Tp53)    05202 Transcriptional misregulation in cancer     100682525 (Tp53)    05206 MicroRNAs in cancer     100682525 (Tp53)    05205 Proteoglycans in cancer     100682525 (Tp53)    05203 Viral carcinogenesis     100682525 (Tp53)    05230 Central carbon metabolism in cancer     100682525 (Tp53)   09162 Cancer: specific types    05210 Colorectal cancer     100682525 (Tp53)    05212 Pancreatic cancer     100682525 (Tp53)    05225 Hepatocellular carcinoma     100682525 (Tp53)    05226 Gastric cancer     100682525 (Tp53)    05214 Glioma     100682525 (Tp53)    05216 Thyroid cancer     100682525 (Tp53)    05220 Chronic myeloid leukemia     100682525 (Tp53)    05217 Basal cell carcinoma     100682525 (Tp53)    05218 Melanoma     100682525 (Tp53)    05219 Bladder cancer     100682525 (Tp53)    05215 Prostate cancer     100682525 (Tp53)    05213 Endometrial cancer     100682525 (Tp53)    05224 Breast cancer     100682525 (Tp53)    05222 Small cell lung cancer     100682525 (Tp53)    05223 Non-small cell lung cancer     100682525 (Tp53)   09164 Neurodegenerative disease    05012 Parkinson disease     100682525 (Tp53)    05014 Amyotrophic lateral sclerosis     100682525 (Tp53)    05016 Huntington disease     100682525 (Tp53)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100682525 (Tp53)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100682525 (Tp53)    05161 Hepatitis B     100682525 (Tp53)    05160 Hepatitis C     100682525 (Tp53)    05162 Measles     100682525 (Tp53)    05168 Herpes simplex virus 1 infection     100682525 (Tp53)    05163 Human cytomegalovirus infection     100682525 (Tp53)    05167 Kaposi sarcoma-associated herpesvirus infection     100682525 (Tp53)    05169 Epstein-Barr virus infection     100682525 (Tp53)    05165 Human papillomavirus infection     100682525 (Tp53)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100682525 (Tp53)    01522 Endocrine resistance     100682525 (Tp53)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:cge03000]     100682525 (Tp53)    03036 Chromosome and associated proteins [BR:cge03036]     100682525 (Tp53)    03400 DNA repair and recombination proteins [BR:cge03400]     100682525 (Tp53) Transcription factors [BR:cge03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    p53     100682525 (Tp53) Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      100682525 (Tp53) DNA repair and recombination proteins [BR:cge03400]  Eukaryotic type   Check point factors    Other check point factors     100682525 (Tp53) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  P53 P53_tetramer P53_TAD Motif Other DBs NCBI-GeneID:  100682525 NCBI-ProteinID:  NP_001230905 UniProt:  O09185 LinkDB All DBs AA seq 393 aa AA seqDB search MEEPQSDLSIELPLSQETFSDLWKLLPPNNVLSTLPSSDSIEELFLSENVTGWLEDSGGA LQGVAAAAASTAEDPVTETPAPVASAPATPWPLSSSVPSYKTYQGDYGFRLGFLHSGTAK SVTCTYSPSLNKLFCQLAKTCPVQLWVNSTPPPGTRVRAMAIYKKLQYMTEVVRRCPHHE RSSEGDSLAPPQHLIRVEGNLHAEYLDDKQTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS SCMGGMNRRPILTIITLEDPSGNLLGRNSFEVRICACPGRDRRTEEKNFQKKGEPCPELP PKSAKRALPTNTSSSPPPKKKTLDGEYFTLKIRGHERFKMFQELNEALELKDAQASKGSE DNGAHSSYLKSKKGQSASRLKKLMIKREGPDSD NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt atggaggagccacagtcagacctcagcatcgagctccctctgagccaggagacattttca gacctgtggaaactacttcctccaaacaatgttctgtccaccttgccgtcatccgattcc attgaagagctgttcctgtcagagaatgttacaggctggttagaagactcaggtggagcg ctccaaggggtggcagcagcagcagcttctacagcagaagaccctgtaactgagactcct gcaccggtggcctctgcaccagccactccctggcccctctcatcttctgtcccatcctat aaaacctaccagggtgactatggcttccgtctgggcttcctgcactcagggacggccaaa tctgtcacgtgcacgtactccccttccctaaataagctattttgccagctggcaaaaaca tgccctgtgcagctgtgggtcaactccacccctccacctggcacccgtgtccgtgccatg gccatctacaagaagctacaatacatgacagaagttgtaagacgctgccctcaccacgag cgctcctccgaaggcgatagtttggctcctcctcagcatcttatccgagtggaaggaaat ttgcatgccgagtacctggatgacaagcaaacatttcggcacagtgtggtggtaccatat gagccacctgaggttggctctgactgtaccaccatccattacaactacatgtgcaatagt tcctgcatggggggcatgaaccggcggcccatccttaccatcatcacactggaagacccc agtggtaacctgctgggacggaacagctttgaggttcgtatttgtgcctgtcctgggaga gaccgtcgtaccgaggaaaaaaatttccagaaaaaaggagaaccttgcccagagctgccc ccaaagagtgctaaacgagcattgcctaccaacacaagctcctctcccccgccaaagaaa aaaacacttgatggagaatatttcacccttaagatccgaggtcatgagcgcttcaagatg tttcaagagctgaatgaggccttggaattgaaggatgctcaggcttcaaaggggtcagag gacaatggtgctcactccagctacctgaagtccaagaagggccagtctgcctcccgtctt aaaaaactaatgatcaagagagaggggcctgactcggactga

DBGET integrated database retrieval system