KEGG   Cricetulus griseus (Chinese hamster): 100682525
Entry
100682525         CDS       T02813                                 

Gene name
Tp53
Definition
(RefSeq) cellular tumor antigen p53
  KO
K04451  tumor protein p53
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04010  MAPK signaling pathway
cge04071  Sphingolipid signaling pathway
cge04110  Cell cycle
cge04115  p53 signaling pathway
cge04137  Mitophagy - animal
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04216  Ferroptosis
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04722  Neurotrophin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge05012  Parkinson disease
cge05014  Amyotrophic lateral sclerosis
cge05016  Huntington disease
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05217  Basal cell carcinoma
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100682525 (Tp53)
   04310 Wnt signaling pathway
    100682525 (Tp53)
   04071 Sphingolipid signaling pathway
    100682525 (Tp53)
   04151 PI3K-Akt signaling pathway
    100682525 (Tp53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100682525 (Tp53)
  09143 Cell growth and death
   04110 Cell cycle
    100682525 (Tp53)
   04210 Apoptosis
    100682525 (Tp53)
   04216 Ferroptosis
    100682525 (Tp53)
   04115 p53 signaling pathway
    100682525 (Tp53)
   04218 Cellular senescence
    100682525 (Tp53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100682525 (Tp53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100682525 (Tp53)
  09149 Aging
   04211 Longevity regulating pathway
    100682525 (Tp53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100682525 (Tp53)
   05202 Transcriptional misregulation in cancer
    100682525 (Tp53)
   05206 MicroRNAs in cancer
    100682525 (Tp53)
   05205 Proteoglycans in cancer
    100682525 (Tp53)
   05203 Viral carcinogenesis
    100682525 (Tp53)
   05230 Central carbon metabolism in cancer
    100682525 (Tp53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100682525 (Tp53)
   05212 Pancreatic cancer
    100682525 (Tp53)
   05225 Hepatocellular carcinoma
    100682525 (Tp53)
   05226 Gastric cancer
    100682525 (Tp53)
   05214 Glioma
    100682525 (Tp53)
   05216 Thyroid cancer
    100682525 (Tp53)
   05220 Chronic myeloid leukemia
    100682525 (Tp53)
   05217 Basal cell carcinoma
    100682525 (Tp53)
   05218 Melanoma
    100682525 (Tp53)
   05219 Bladder cancer
    100682525 (Tp53)
   05215 Prostate cancer
    100682525 (Tp53)
   05213 Endometrial cancer
    100682525 (Tp53)
   05224 Breast cancer
    100682525 (Tp53)
   05222 Small cell lung cancer
    100682525 (Tp53)
   05223 Non-small cell lung cancer
    100682525 (Tp53)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100682525 (Tp53)
   05014 Amyotrophic lateral sclerosis
    100682525 (Tp53)
   05016 Huntington disease
    100682525 (Tp53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100682525 (Tp53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100682525 (Tp53)
   05161 Hepatitis B
    100682525 (Tp53)
   05160 Hepatitis C
    100682525 (Tp53)
   05162 Measles
    100682525 (Tp53)
   05168 Herpes simplex virus 1 infection
    100682525 (Tp53)
   05163 Human cytomegalovirus infection
    100682525 (Tp53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100682525 (Tp53)
   05169 Epstein-Barr virus infection
    100682525 (Tp53)
   05165 Human papillomavirus infection
    100682525 (Tp53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100682525 (Tp53)
   01522 Endocrine resistance
    100682525 (Tp53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cge03000]
    100682525 (Tp53)
   03036 Chromosome and associated proteins [BR:cge03036]
    100682525 (Tp53)
   03400 DNA repair and recombination proteins [BR:cge03400]
    100682525 (Tp53)
Transcription factors [BR:cge03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    100682525 (Tp53)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100682525 (Tp53)
DNA repair and recombination proteins [BR:cge03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100682525 (Tp53)
SSDB
Motif
Pfam: P53 P53_tetramer P53_TAD
Other DBs
NCBI-GeneID: 100682525
NCBI-ProteinID: NP_001230905
UniProt: O09185
LinkDB
AA seq 393 aa
MEEPQSDLSIELPLSQETFSDLWKLLPPNNVLSTLPSSDSIEELFLSENVTGWLEDSGGA
LQGVAAAAASTAEDPVTETPAPVASAPATPWPLSSSVPSYKTYQGDYGFRLGFLHSGTAK
SVTCTYSPSLNKLFCQLAKTCPVQLWVNSTPPPGTRVRAMAIYKKLQYMTEVVRRCPHHE
RSSEGDSLAPPQHLIRVEGNLHAEYLDDKQTFRHSVVVPYEPPEVGSDCTTIHYNYMCNS
SCMGGMNRRPILTIITLEDPSGNLLGRNSFEVRICACPGRDRRTEEKNFQKKGEPCPELP
PKSAKRALPTNTSSSPPPKKKTLDGEYFTLKIRGHERFKMFQELNEALELKDAQASKGSE
DNGAHSSYLKSKKGQSASRLKKLMIKREGPDSD
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggaggagccacagtcagacctcagcatcgagctccctctgagccaggagacattttca
gacctgtggaaactacttcctccaaacaatgttctgtccaccttgccgtcatccgattcc
attgaagagctgttcctgtcagagaatgttacaggctggttagaagactcaggtggagcg
ctccaaggggtggcagcagcagcagcttctacagcagaagaccctgtaactgagactcct
gcaccggtggcctctgcaccagccactccctggcccctctcatcttctgtcccatcctat
aaaacctaccagggtgactatggcttccgtctgggcttcctgcactcagggacggccaaa
tctgtcacgtgcacgtactccccttccctaaataagctattttgccagctggcaaaaaca
tgccctgtgcagctgtgggtcaactccacccctccacctggcacccgtgtccgtgccatg
gccatctacaagaagctacaatacatgacagaagttgtaagacgctgccctcaccacgag
cgctcctccgaaggcgatagtttggctcctcctcagcatcttatccgagtggaaggaaat
ttgcatgccgagtacctggatgacaagcaaacatttcggcacagtgtggtggtaccatat
gagccacctgaggttggctctgactgtaccaccatccattacaactacatgtgcaatagt
tcctgcatggggggcatgaaccggcggcccatccttaccatcatcacactggaagacccc
agtggtaacctgctgggacggaacagctttgaggttcgtatttgtgcctgtcctgggaga
gaccgtcgtaccgaggaaaaaaatttccagaaaaaaggagaaccttgcccagagctgccc
ccaaagagtgctaaacgagcattgcctaccaacacaagctcctctcccccgccaaagaaa
aaaacacttgatggagaatatttcacccttaagatccgaggtcatgagcgcttcaagatg
tttcaagagctgaatgaggccttggaattgaaggatgctcaggcttcaaaggggtcagag
gacaatggtgctcactccagctacctgaagtccaagaagggccagtctgcctcccgtctt
aaaaaactaatgatcaagagagaggggcctgactcggactga

DBGET integrated database retrieval system