KEGG   Cricetulus griseus (Chinese hamster): 100689008
Entry
100689008         CDS       T02813                                 

Definition
(RefSeq) MHC class I antigen Hm1-C5 isoform X1
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100689008
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100689008
   04145 Phagosome
    100689008
  09143 Cell growth and death
   04218 Cellular senescence
    100689008
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100689008
   04612 Antigen processing and presentation
    100689008
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100689008
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100689008
   05330 Allograft rejection
    100689008
   05332 Graft-versus-host disease
    100689008
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100689008
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100689008
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100689008
   05170 Human immunodeficiency virus 1 infection
    100689008
   05168 Herpes simplex virus 1 infection
    100689008
   05163 Human cytomegalovirus infection
    100689008
   05167 Kaposi sarcoma-associated herpesvirus infection
    100689008
   05169 Epstein-Barr virus infection
    100689008
   05165 Human papillomavirus infection
    100689008
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100689008
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100689008
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100689008
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100689008
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Gram_pos_anchor
Other DBs
NCBI-GeneID: 100689008
NCBI-ProteinID: XP_027244760
UniProt: Q8MHC1
LinkDB
Position
1
AA seq 348 aa
MRAVAPPTLLLLLAAAQVPTQTRAGSHSLRYFQTTVSRPGLGEPRYMEVGYVDDTQFVRF
DSDAENPRMEPRAPWMAREGPEYWEWNTRYAKDNAQIDRGSLRNLLGYYNQSEDGSHTIQ
RMYGCHVGLDGRLLRGYEQYAYDGDDYIALNEDLRTWTAADTAAQITRRKLEQAGFADRQ
RAYLEEECVGWLRRHLEHGKDQLLRTDPPKAHVTHHPGPKGDVTLRCWVMGFYPADITLI
WQREEEEQTQDMELVETRPSGDGTFQKWAAVVVPSGEEQKYTCHVHHEGLPEPLTLRWEP
PPQSTVPIMAVIAALGLIGAVIIGALVFFVRKRRNSGGKEGTYAPAPA
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgcgggcggtggcgccgcccacgctgctcctgctgctggcggccgcccaggtcccgacc
cagacccgcgcgggctcgcactcgctgcggtatttccaaaccaccgtgtcccggcccggc
ctcggggagccccggtacatggaagtcggctacgtggacgacacgcagttcgtgcgcttc
gacagcgacgcggagaatccgaggatggagccgcgggcgccatggatggcgcgggagggg
ccggagtattgggagtggaacactcggtacgccaaggacaacgcgcagattgaccgaggg
agcctcaggaacctgctcggctactacaaccagagcgaggacggctctcacaccatccag
aggatgtacggctgtcacgtggggttggacgggcgcctcctccgcgggtatgaacagtac
gcctacgacggcgacgattacatcgccctgaacgaggacctgaggacgtggacagcggcg
gacacggcggcgcagatcacccggcgcaagttggagcaggctggttttgcagacagacag
agagcctacctggaggaggagtgcgtgggatggctccgcagacacctggagcacgggaag
gaccagctgctgcgcacagatcccccaaaggcacatgtgacccatcatcctggacctaaa
ggtgatgtcaccctgaggtgttgggtcatgggcttctaccctgctgacatcaccctgatc
tggcagagggaggaggaagaacagactcaggacatggagctggtggagaccagaccttct
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggggaggagcagaaa
tacacatgccatgtgcaccatgaggggctgcctgagcccctcaccctgagatgggagcct
cctcctcagtccactgtccccatcatggcagtcattgctgctctgggtctcattggagct
gtgatcattggagctttggtgttttttgtgaggaagaggagaaactcaggtggaaaagaa
gggacctatgctccagctccagcataa

KEGG   Cricetulus griseus (Chinese hamster): 100689009
Entry
100689009         CDS       T02813                                 

Definition
(RefSeq) MHC class I antigen Hm1-C4 precursor
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100689009
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100689009
   04145 Phagosome
    100689009
  09143 Cell growth and death
   04218 Cellular senescence
    100689009
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100689009
   04612 Antigen processing and presentation
    100689009
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100689009
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100689009
   05330 Allograft rejection
    100689009
   05332 Graft-versus-host disease
    100689009
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100689009
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100689009
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100689009
   05170 Human immunodeficiency virus 1 infection
    100689009
   05168 Herpes simplex virus 1 infection
    100689009
   05163 Human cytomegalovirus infection
    100689009
   05167 Kaposi sarcoma-associated herpesvirus infection
    100689009
   05169 Epstein-Barr virus infection
    100689009
   05165 Human papillomavirus infection
    100689009
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100689009
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100689009
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100689009
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100689009
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Psg1 EphA2_TM
Other DBs
NCBI-GeneID: 100689009
NCBI-ProteinID: NP_001230923
UniProt: Q8MHC2
LinkDB
AA seq 364 aa
MGAVAPRTLLLLLAAALAPTQTRAGSHSLRYFHTAVSRPGLGEPRYISVGYVDHTEFVRF
DSDAENPRYEPRAPWVQREGPEYWEEETRRAKGNAQNDRVSLRNLLGYYNQSEGGSHTIQ
SMYGCHVGSDGRLLRGYRQVAYDGDDYIALNEVLRTLTAADTAAQITRRKWEQAGVADAW
RAYLEEECVESLGRYLEHGKDQLLRTDPPKAHVTHHPGPKGDVTLRCWAMGFYPAEITLT
WQREEEEQSQDMELVETRPSGDGTFQKWAAVVVPSGEEQKYTCHVYHEGLPEPLTLRWEP
PPQSTVCFLAVIAALVLIGAVIIGAVVFFVRKRRNSGGKEGTYAPAPGRDSSQSSDVSLS
DCKA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgggtgcagttgccccgcgcacgctgctcctgctgctggcggccgccctggccccgacc
cagacccgcgcgggctcgcactcgctgcggtatttccacaccgccgtgtcccggcccggc
ctcggggagccccggtacatctctgtcggctacgtggaccacacggagttcgtgcgcttc
gacagcgacgccgagaatccgagatacgagccgcgggcgccgtgggtgcagcgggagggg
ccggagtattgggaggaggagacgcggagagccaagggcaacgcgcagaatgaccgagtg
agcctcaggaacctgctcggctactacaaccagagcgagggcggctctcacaccatccag
agtatgtacggctgtcacgtggggtcggacgggcgcctcctccgcgggtaccgtcaggtc
gcctacgacggcgacgattacatcgccctgaacgaggtcctgaggacgttgacggcggcg
gacacggcggcgcagatcacccggcgcaagtgggagcaggctggtgttgcagacgcatgg
agggcctacctggaggaggagtgcgtggagtctctgggcagatacctggagcacgggaag
gaccagctgctgcgcacagatcccccaaaggcacatgtgacccatcatcctggacctaaa
ggtgatgtcaccctgaggtgctgggccatgggcttctaccctgctgagatcaccctgact
tggcagagggaggaggaagaacagagtcaggacatggagctggtggagaccagaccttct
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggggaggagcagaaa
tacacatgccatgtgtaccatgaggggctgcctgagcccctcaccctgagatgggagcct
cctcctcagtccactgtctgcttcttggctgtcattgctgctctggttctcattggagct
gtgatcattggagctgtggtgttttttgtgaggaagaggagaaactcaggtggaaaagaa
gggacctatgctccagctccaggcagggacagttcccagagctcggatgtgtctctctca
gattgtaaagcttga

KEGG   Cricetulus griseus (Chinese hamster): 100689010
Entry
100689010         CDS       T02813                                 

Definition
(RefSeq) MHC class I antigen Hm1-C2 precursor
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100689010
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100689010
   04145 Phagosome
    100689010
  09143 Cell growth and death
   04218 Cellular senescence
    100689010
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100689010
   04612 Antigen processing and presentation
    100689010
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100689010
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100689010
   05330 Allograft rejection
    100689010
   05332 Graft-versus-host disease
    100689010
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100689010
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100689010
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100689010
   05170 Human immunodeficiency virus 1 infection
    100689010
   05168 Herpes simplex virus 1 infection
    100689010
   05163 Human cytomegalovirus infection
    100689010
   05167 Kaposi sarcoma-associated herpesvirus infection
    100689010
   05169 Epstein-Barr virus infection
    100689010
   05165 Human papillomavirus infection
    100689010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100689010
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100689010
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100689010
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100689010
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig MHC_I_C
Other DBs
NCBI-GeneID: 100689010
NCBI-ProteinID: NP_001230924
UniProt: Q8MHC4
LinkDB
AA seq 349 aa
MGAVAPRTLLLLLAAALAPTQTRAGSHSLRYFQTAVSRPGLGEPRYISVGYVDDTEFVRF
DSDAENPRYEPRAPWVQREGPEYWERNTRIAKGNAQNDRVNLRTLLGYYNQSEGGSHTIQ
RMFGCEVGSDGRLLRGYSQDAYDGDDYIALNEDLRTWTAADTAAQITRRKWEQAGFADRR
RAYLEGTCVEWLGRYLEHGKDQLLRTDPPKAHVTHHPGPKGDVTLRCWALGFYPDVITLT
WQREEEEQTQDMELVETRPSGDGTFQKWASLVVPSGEEQKYTCHVYHEGLPEPLTLRWEP
PPQSTVLIMAVIAALVLLGAVTIIGAVVFFVGKRRNSGGKGGNYAPAPA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgggggcggtggcgccgcgcacgctgctcctgctgctggcggccgccctggccccgacc
cagacccgcgcgggctctcactcgctgaggtatttccaaaccgccgtctcccggcccggc
ctcggggagccccggtacatctctgtcggctacgtggacgacacggagttcgtgcgcttc
gacagcgacgccgagaatccgagatacgagccgcgggcgccgtgggtgcagcgggagggg
ccggagtattgggagaggaacacgcggatcgccaagggcaacgcgcagaatgaccgagtg
aacctgaggaccctgctcggctactacaaccagagcgagggcggctctcacaccatccag
aggatgttcggctgtgaagtggggtcggacgggcgtctcctccgcgggtacagtcaggac
gcctacgacggcgacgattacatcgccctgaacgaggacctgaggacgtggacggcggcg
gacactgcggcgcagatcacccggcgcaagtgggagcaggctggttttgcagacagacgc
agggcttacctggagggcacgtgcgtggagtggctcggcagatacctggagcacgggaag
gaccagctgctgcgcacagatcccccaaaggcacatgtgacccatcatcctggacctaaa
ggtgatgtcaccctgaggtgctgggccctgggcttctaccctgatgtcatcaccctgacc
tggcagagggaggaggaagaacagactcaggacatggagctggtggagaccagaccttct
ggggatggaaccttccagaagtgggcatctctggtggtgccttctggggaggagcagaaa
tacacatgccatgtgtaccatgaggggctgcctgagcccctcaccctgagatgggagcct
cctcctcagtccactgtcctcatcatggcagtcattgctgctctggttctccttggagct
gtgaccatcattggagctgtggtgttctttgtggggaagaggagaaactcaggtggaaaa
ggagggaactatgctccagctccagcgtga

KEGG   Cricetulus griseus (Chinese hamster): 100689011
Entry
100689011         CDS       T02813                                 

Definition
(RefSeq) MHC class I antigen Hm1-C3 precursor
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100689011
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100689011
   04145 Phagosome
    100689011
  09143 Cell growth and death
   04218 Cellular senescence
    100689011
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100689011
   04612 Antigen processing and presentation
    100689011
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100689011
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100689011
   05330 Allograft rejection
    100689011
   05332 Graft-versus-host disease
    100689011
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100689011
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100689011
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100689011
   05170 Human immunodeficiency virus 1 infection
    100689011
   05168 Herpes simplex virus 1 infection
    100689011
   05163 Human cytomegalovirus infection
    100689011
   05167 Kaposi sarcoma-associated herpesvirus infection
    100689011
   05169 Epstein-Barr virus infection
    100689011
   05165 Human papillomavirus infection
    100689011
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100689011
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100689011
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100689011
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100689011
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Gram_pos_anchor Psg1
Other DBs
NCBI-GeneID: 100689011
NCBI-ProteinID: NP_001230926
UniProt: Q8MHC3
LinkDB
AA seq 361 aa
MWTMASVSRLQLLLTQVALVLIQTQASSHSLRYFSTIVSRPGLGEPRFIYVGYVDDRQIV
RYDSDAENPRMEPRAPWMEREGPGYWERETRKAKDTGKNFRSNLKTLLGYYNQSDDEPHT
LQWMYGCDVGPDGRLLRGYCQEAYDGHDYISLNEDLRSWTANDLASQISKQKSENVDEAH
HQRAYLQGPCIEWLLKYLELGKSTLLLSDPPKAYVTHHPGYKGDVTLRCWAMGFYPADIT
LTWQREEEEQTQDMELVETRPSGDGTFQKWAAVVVPSGEEQKYTCHVHHERLPEPLTLRW
EPPPQSTVPIMAVIAALVLLGAVTIIGAVVFFVRKRRNSGGKGGYDHFVGRVSAESSDVS
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtggaccatggcttctgtttccaggctccagctcctcctgactcaagttgccctagtt
ctgatccagacacaagcgagctcgcactcgctgcggtatttctccaccatcgtctcccgg
cccggcctcggggagccccggttcatctatgtcggctacgtggacgacaggcagatcgtg
cgctacgacagcgacgccgagaatccgaggatggagccgcgggcgccgtggatggagcgg
gaggggccggggtattgggaaagggagacgcggaaagccaaggacacagggaagaacttc
agatcgaacctcaagaccctgctcggctactacaaccagagtgacgatgaacctcacacg
ctgcagtggatgtacgggtgcgacgtcgggccggacgggcgcctgctccgcgggtattgt
caggaggcctacgacggccacgattacatctccttaaacgaggacctgcgctcctggacc
gcaaatgacctggcctctcagatctctaagcagaagtcagagaacgtagacgaggcccac
caccagagggcctacctgcagggcccgtgcatagagtggctgctgaagtacctggagttg
gggaagtcgactctgctgctctcagaccccccaaaggcatatgtgacccatcatcctgga
tataaaggtgatgtcaccctgaggtgctgggccatgggcttctaccctgctgacatcacc
ctgacctggcagagggaggaggaagaacagactcaggacatggagctggtggagaccaga
ccttctggggatggaaccttccagaagtgggcagctgtggtggtgccttctggggaggag
cagaaatacacatgccatgtgcaccatgagcggctgcctgagcccctcaccctgagatgg
gagcctcctcctcagtccactgtccccatcatggcagtcattgctgctctggttctcctt
ggagctgtgaccatcattggagctgtggtgttctttgtgaggaagaggagaaactcaggt
ggaaaaggaggctatgaccattttgtaggcagggtcagtgccgagagctctgatgtgtct
ctgtag

KEGG   Cricetulus griseus (Chinese hamster): 100751378
Entry
100751378         CDS       T02813                                 

Definition
(RefSeq) popy Class I histocompatibility antigen, A-1 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100751378
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100751378
   04145 Phagosome
    100751378
  09143 Cell growth and death
   04218 Cellular senescence
    100751378
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100751378
   04612 Antigen processing and presentation
    100751378
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100751378
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100751378
   05330 Allograft rejection
    100751378
   05332 Graft-versus-host disease
    100751378
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100751378
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100751378
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100751378
   05170 Human immunodeficiency virus 1 infection
    100751378
   05168 Herpes simplex virus 1 infection
    100751378
   05163 Human cytomegalovirus infection
    100751378
   05167 Kaposi sarcoma-associated herpesvirus infection
    100751378
   05169 Epstein-Barr virus infection
    100751378
   05165 Human papillomavirus infection
    100751378
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100751378
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100751378
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100751378
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100751378
SSDB
Motif
Pfam: MHC_I C1-set C2-set_2 MHC_I_2
Other DBs
NCBI-GeneID: 100751378
NCBI-ProteinID: XP_027244438
LinkDB
Position
1
AA seq 342 aa
MSLVASKPLLMSAFLPLLIGALALTQVRAGFHSLQFFATIVSQPGVREPSFIFVGFVDDT
QFLCYNNQGKSQRMEPRAMWVRQMGPSYWERQTQIVKDIAKNSLVNLREAMGVYNHSEDG
SHVFQCVSGCDVGPKGVFLRGYEQHAYDGRDYLALNQDLRSWTAGDSAAQITLRKWEEAG
VTEQRRSYLKGECVESLRTYLDIGKETLLGADPPKAYVTHHPRPEGDSILRCWALGFYPS
DITLIWQLDEEDQTQDMDLIETRPAGDGTFQKWAAMVVPSGEEQRYTCHVQHEALTQPLV
LKWDPPKPTTPIMGIIAALIFLGVVFTGAVAAIVMRKRRGKE
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgtctcttgtggcttcaaaaccactcttgatgtctgccttcctaccgctgctcattgga
gctttggccttgacccaggtccgcgcaggcttccattccttgcagttttttgctaccatc
gtgtcccagcctggtgtgagggagccttccttcatcttcgtcggcttcgtggacgacaca
cagttcctgtgctacaacaaccaggggaaaagtcagagaatggagccccgcgcgatgtgg
gtgaggcagatggggccctcatattgggagaggcagacccagatagtcaaggacattgca
aagaattcgctagtgaacttgcgggaggctatgggcgtctacaaccacagcgaggatggc
tctcacgtctttcagtgtgtgtctggctgcgacgtggggccaaagggggtcttcctccgc
gggtatgagcagcacgcctacgacggccgcgactacctcgccctaaaccaggacctgcgc
tcctggaccgcaggcgactcggcggcacagatcacactgcgcaagtgggaggaggctggt
gtcaccgaacagaggcgatcctatctgaagggcgagtgtgtggagtcgctccgcacatac
ctagacatagggaaggagactcttctaggagcagatcctccaaaggcatatgtgacccat
caccctagacctgaaggagacagcatcctgaggtgctgggccctgggcttctacccttca
gacatcaccctgatctggcagctggatgaagaggaccagacccaggacatggaccttatt
gagaccaggcctgcaggggatggaaccttccagaagtgggcagctatggtggtgccttca
ggagaggagcagagatacacatgccatgtacagcatgaagcactaacccagccccttgtt
ctgaaatgggaccctcctaaacccactacacccatcatgggaattattgctgctctgatt
ttccttggagttgtgttcactggagctgtggctgccattgtgatgaggaagaggagaggt
aaggaatga

KEGG   Cricetulus griseus (Chinese hamster): 100751667
Entry
100751667         CDS       T02813                                 

Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100751667
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100751667
   04145 Phagosome
    100751667
  09143 Cell growth and death
   04218 Cellular senescence
    100751667
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100751667
   04612 Antigen processing and presentation
    100751667
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100751667
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100751667
   05330 Allograft rejection
    100751667
   05332 Graft-versus-host disease
    100751667
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100751667
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100751667
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100751667
   05170 Human immunodeficiency virus 1 infection
    100751667
   05168 Herpes simplex virus 1 infection
    100751667
   05163 Human cytomegalovirus infection
    100751667
   05167 Kaposi sarcoma-associated herpesvirus infection
    100751667
   05169 Epstein-Barr virus infection
    100751667
   05165 Human papillomavirus infection
    100751667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100751667
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100751667
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100751667
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100751667
SSDB
Motif
Pfam: MHC_I C1-set ig C2-set_2
Other DBs
NCBI-GeneID: 100751667
NCBI-ProteinID: XP_035307304
LinkDB
Position
1
AA seq 343 aa
MGSAVPHTLLLLLAAALPPTQACAGSHSLRYFSTAFHNPDNNKPRVMVVGYVDNTEILSF
DSDEASQQVKPRVPFMAQDREHLEELTRLGRRVLIVGRIELRILFSYRSQRENGSLTIQE
LCGCDVGPDHRLLHGYKQIAYEGQDYISLTEDMRSWTAVDIKEAQITRRKWEASGFAKLF
RSFFEGSCVAWLLRYLDKGKEMLLRAEPPKTNVTHHPRPEGEATLKCWALGFYPADITLI
WQKEEEDLTQDMDLIETRPAGDGTFQKWAAVVVPSGEEQRYTCHVNHEGLPEPLILRWEP
PPSPTPPIMGIVAGLVLLGVLVTGAVAAIVMRKNTEMEKDVVR
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggggtccgcggtgccacacaccctccttctgttgctggcggccgccctgcccccaact
caggcctgcgcgggctcacactccctgaggtatttctccaccgccttccacaatcctgac
aacaacaaacctcgggtcatggtcgtgggctacgtggacaacacggagatcttgagcttc
gacagtgacgaggcgagtcagcaggtgaagccgcgggtgccgtttatggctcaggaccga
gagcacttggaggagctgacgcgcctaggcaggcgcgtcttaatagttggccgaattgaa
ctgaggatcctgttcagctaccgtagccagagagagaatgggtctttgactatccaggag
ctgtgtggctgcgacgtagggccggaccaccgcctcctccatgggtataagcagatagct
tatgaaggccaggattacatctctctgaccgaggacatgcgctcttggaccgctgtggat
atcaaggaggctcagatcacccggcgcaagtgggaggcatctggctttgcaaagttattt
aggtctttcttcgagggcagttgtgtggcgtggcttctgagatacctggataaagggaag
gagatgctgctgcgtgcagagcctccaaaaacaaatgtgactcatcaccccagacctgaa
ggagaggccaccctaaagtgctgggccctgggcttctatcctgcggacatcaccctgatc
tggcagaaggaggaggaggacctgacccaggacatggatcttatagagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtaccttcaggagaggagcagaga
tacacatgtcatgtgaatcatgaggggctgcctgagcccctcatcctgagatgggagcct
cccccctctcccaccccccctatcatggggatcgttgctggtctggttctccttggtgtc
ttggtcactggagctgtggctgccattgtgatgaggaagaacacagagatggaaaaggat
gtagttagataa

KEGG   Cricetulus griseus (Chinese hamster): 100751953
Entry
100751953         CDS       T02813                                 

Definition
(RefSeq) class I histocompatibility antigen, Gogo-B*0102 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100751953
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100751953
   04145 Phagosome
    100751953
  09143 Cell growth and death
   04218 Cellular senescence
    100751953
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100751953
   04612 Antigen processing and presentation
    100751953
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100751953
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100751953
   05330 Allograft rejection
    100751953
   05332 Graft-versus-host disease
    100751953
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100751953
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100751953
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100751953
   05170 Human immunodeficiency virus 1 infection
    100751953
   05168 Herpes simplex virus 1 infection
    100751953
   05163 Human cytomegalovirus infection
    100751953
   05167 Kaposi sarcoma-associated herpesvirus infection
    100751953
   05169 Epstein-Barr virus infection
    100751953
   05165 Human papillomavirus infection
    100751953
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100751953
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100751953
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100751953
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100751953
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 100751953
NCBI-ProteinID: XP_035306470
LinkDB
Position
1
AA seq 304 aa
MGTAVLSATLLLLLLLQALTQTKTQTGSHSMRYFVTTTASIMGLGDPQVFIVGYVDDTQF
LRFDSEAATKVEPRVPWAKQMGSNYWKWERKGMEHYSHTARENLRFALQIYNQSDDGSHT
FQCLIGCDVGPDRIFLRGHNRHAFDGRDYISLNEDMRTWTVADKTAQITQRQWEAKNVAE
HWRIFFEGWCFAWLLGHLELGKDILQRSDPPKAHVTHHPTPEGDVTLKCWALGFYPAEIT
LTWQRDGKDQTQDMEVMDTRPAGDGSFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLILRW
GKEV
NT seq 915 nt   +upstreamnt  +downstreamnt
atggggacagcagtgctgtctgccaccctcctgctgctcttgctactccaggctctgacc
cagaccaagacccagactggctcacactccatgcggtattttgtaaccaccactgcatct
ataatgggtctcggagatccccaagtcttcatcgttggctatgtggacgacactcaattc
ctgcgctttgacagtgaggcagctactaaagtggagccccgtgtaccatgggcgaagcaa
atggggtccaattattggaagtgggagagaaagggtatggagcattattcgcacacggcc
cgagaaaacctgcgatttgcactccagatctataaccagagcgatgacggatctcatacc
ttccagtgtttgattggttgtgacgtgggtccagacagaatcttcctccgcgggcacaat
aggcatgcctttgatggccgcgattacatcagcctgaacgaggacatgagaacttggact
gtggcagacaagacagctcagatcacccagcggcagtgggaggcaaaaaatgtagcagaa
cactggaggatcttctttgagggctggtgctttgcttggctactcgggcacctggagcta
gggaaggatattctgcagcgctcagatcctccaaaagcacatgtaacccatcaccctaca
cctgaaggtgatgtcaccttgaagtgctgggccctgggattctacccagctgagatcacc
ctgacctggcagagggatggaaaagaccagacccaggacatggaggtgatggacaccagg
cctgcaggagatggaagcttccagaagtgggcagctgtggtggtgccttctggggaggag
cagagatacacatgccatgtgcagcatgagggtctgcctgagcccctcatcctgagatgg
ggtaaggaggtgtag

KEGG   Cricetulus griseus (Chinese hamster): 100753528
Entry
100753528         CDS       T02813                                 

Definition
(RefSeq) RT1 class I histocompatibility antigen, AA alpha chain isoform X2
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100753528
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100753528
   04145 Phagosome
    100753528
  09143 Cell growth and death
   04218 Cellular senescence
    100753528
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100753528
   04612 Antigen processing and presentation
    100753528
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100753528
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100753528
   05330 Allograft rejection
    100753528
   05332 Graft-versus-host disease
    100753528
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100753528
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100753528
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100753528
   05170 Human immunodeficiency virus 1 infection
    100753528
   05168 Herpes simplex virus 1 infection
    100753528
   05163 Human cytomegalovirus infection
    100753528
   05167 Kaposi sarcoma-associated herpesvirus infection
    100753528
   05169 Epstein-Barr virus infection
    100753528
   05165 Human papillomavirus infection
    100753528
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100753528
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100753528
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100753528
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100753528
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2
Other DBs
NCBI-GeneID: 100753528
NCBI-ProteinID: XP_035306834
LinkDB
Position
1
AA seq 339 aa
MGSPLLWDLLLLVASQALTQTRAGSHSLLYFRTIVSRPGLGEPRFIAVGYVDDTQFVRFD
SDAESLRYEPLTTWAKREGLEHWERQTRFVKISEQIYRGNLRTLLDYYNQSEGGSHSIQV
MYGCDMGSDGRLLRGYRQDAYDGRDYIALNEDLRTWTPADRAAQITRRKWEQTGFAENEK
AYVEGTCLEWLRRYLENGKDQLLRTDPPRVHVTHHPGPKGDVTLRCWALGFYPADITMTW
QREEEEQTQDMELVETRPSGDGTFQKWASLVVPSGEEQKYTCHVHHEGLPEPLTLRWEPP
PQSTVPIMAVIAVLVLLESVAIIGAVVAVVRKRRNTGGQ
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggggagccctctgctctgggacctcctgctgctggtggcctcccaggccctgacccaa
acccgcgcaggctcgcactccctgctgtatttccgcaccattgtgtcccggcccggcctt
ggggagccccggttcatcgccgtcggctacgtggacgacacgcagttcgtgcgcttcgac
agcgacgcggagagtctgagatatgagccgctgaccacgtgggcgaagcgggagggactt
gagcattgggagaggcagacacggtttgtcaaaatcagcgagcagatttaccgagggaat
ctaaggaccctgctcgactactacaaccagagtgagggcggctctcactccatccaggtg
atgtatggctgtgacatggggtcggacgggcgcctcctccgcgggtaccgtcaggacgcc
tatgatggccgcgattacatcgccctgaacgaggacctgaggacgtggacaccggcggac
agggcggcgcagatcacccgacgcaagtgggagcagactggttttgcagagaatgaaaag
gcctacgtggagggcacgtgcttggagtggctccgcagatacctggagaatgggaaggac
cagctgctgcgcacagatcccccaagggtacatgtgacccatcatcctggacctaaaggt
gatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccatgacctgg
cagagggaggaggaagaacagactcaggacatggagctggtggagaccagaccttctggg
gatggaaccttccagaagtgggcatctctggtggtgccttctggggaggagcagaaatac
acatgccatgtgcaccatgaggggctgcctgagcccctcaccctgagatgggaacctcct
cctcagtccactgtccccatcatggcagtcattgctgttctggttctcctcgaatctgtg
gccatcattggagctgtggtggctgtggtgaggaagaggagaaacacaggtggacaatga

KEGG   Cricetulus griseus (Chinese hamster): 100757234
Entry
100757234         CDS       T02813                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, alpha chain
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100757234
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100757234
   04145 Phagosome
    100757234
  09143 Cell growth and death
   04218 Cellular senescence
    100757234
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100757234
   04612 Antigen processing and presentation
    100757234
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100757234
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100757234
   05330 Allograft rejection
    100757234
   05332 Graft-versus-host disease
    100757234
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100757234
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100757234
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100757234
   05170 Human immunodeficiency virus 1 infection
    100757234
   05168 Herpes simplex virus 1 infection
    100757234
   05163 Human cytomegalovirus infection
    100757234
   05167 Kaposi sarcoma-associated herpesvirus infection
    100757234
   05169 Epstein-Barr virus infection
    100757234
   05165 Human papillomavirus infection
    100757234
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100757234
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100757234
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100757234
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100757234
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig
Other DBs
NCBI-GeneID: 100757234
NCBI-ProteinID: XP_027244485
LinkDB
Position
1
AA seq 363 aa
MKTLAPQALLLLLLANLAPTNINRLDQPVPFSILHSDPQPLLKTLNWSPQAPAWDPSRKP
HFILGVYLDDIHIQRFNTIAQTRRLEHCAPWVDEHQPQYWDNVTRDILALIDIYNDLLKK
VLHLYNQSETGYHTVQILIACDVLPGGKFSHGQCKLIFDGHDYIALNEDLNTWTAFGKAA
EILMEEWENTAFAKSVTPYLMNGCVHYLLKELHYEKAFLMRTDIPKLHVTHKVRADGNIT
LRCWALDIYHAEITLTWQRDGSNQNLDMEVIETRPAGDGTFQKWAAVVVPPGEEQRYTCH
VNHEGLPEPLTLRWETPKPSVPIMPIVIGLVLGAVLMGAVVTFLIWKRRNKGKENAGSEF
LSL
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaagacccttgcaccccaggctctcctgctgctgctcctggccaacctggctcctacc
aatatcaacaggctagaccagcctgttcccttctccattctgcattctgacccccaaccc
ctgctgaagaccctcaattggagcccccaggcaccagcatgggatcccagtaggaagccc
cacttcatccttggtgtctacttggatgacattcatattcagagattcaacaccatagca
cagactcggaggctggagcactgtgctccttgggtggatgagcaccagccacaatactgg
gataacgtgacacgggacattctggcactaattgacatctacaatgatttactgaagaaa
gtgcttcacctgtacaatcaaagtgaaactggttatcacacggtgcagatcctgattgcc
tgtgatgtgctgcctggaggaaagttcagtcatggacaatgtaaattaatcttcgatggc
catgattacattgccttgaatgaggacctgaacacttggactgcatttggcaaggcagct
gagatcctgatggaagagtgggagaatacagcgtttgcaaaatctgtgacgccttaccta
atgaatggatgtgtgcactacctcctcaaggagctgcactatgagaaggcgttcttgatg
agaacagacatcccaaaattacatgtgacccataaggtcagagctgatgggaatatcact
ctaaggtgctgggccctggatatctaccatgctgagatcaccctgacctggcagagagat
gggagcaaccagaatctggacatggaggtgatagagaccaggccagcaggagatggaacc
ttccagaagtgggcagctgtggtggtgcctcctggggaggagcagagatacacatgccat
gtgaaccatgaggggctgcctgagcccctcaccctgagatgggagactcctaagccctct
gtccccatcatgccaattgttattggcctggttcttggagctgtgcttatgggagctgtg
gtgacttttctgatatggaagaggaggaataaaggtaaggaaaatgcagggtctgagttc
ctgtctctctga

KEGG   Cricetulus griseus (Chinese hamster): 100757524
Entry
100757524         CDS       T02813                                 

Definition
(RefSeq) popy Class I histocompatibility antigen, A-1 alpha chain-like isoform X2
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100757524
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100757524
   04145 Phagosome
    100757524
  09143 Cell growth and death
   04218 Cellular senescence
    100757524
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100757524
   04612 Antigen processing and presentation
    100757524
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100757524
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100757524
   05330 Allograft rejection
    100757524
   05332 Graft-versus-host disease
    100757524
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100757524
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100757524
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100757524
   05170 Human immunodeficiency virus 1 infection
    100757524
   05168 Herpes simplex virus 1 infection
    100757524
   05163 Human cytomegalovirus infection
    100757524
   05167 Kaposi sarcoma-associated herpesvirus infection
    100757524
   05169 Epstein-Barr virus infection
    100757524
   05165 Human papillomavirus infection
    100757524
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100757524
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100757524
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100757524
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100757524
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig Ig_2 C2-set_2 Rio2_N
Other DBs
NCBI-GeneID: 100757524
NCBI-ProteinID: XP_035307309
LinkDB
Position
1
AA seq 242 aa
MSCAALAGSSYIHGQYEFIFNGYDYLALNEDLSSWTAVGKAAEILHQEWEKAGYAEYWKY
FLEGNCLNSLRSQLKYGKEFLLRTGTLKLHMTHKVRADGNITLRCWALNFYPTEITLTWQ
KDGSNQNLDMEVIETRPSGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPEPLTLRWEPPQ
ASVPIMPIVTGLVLGAVLMGAVVTFLIWKKRNKGKKRAGQDDVGKERREFPDSTKERDSP
EP
NT seq 729 nt   +upstreamnt  +downstreamnt
atgtcctgtgccgcactggctggatcgagctacattcatggacaatatgaatttatcttc
aatggctatgattatcttgcactaaatgaggacctgagttcttggactgcagtgggcaag
gcagctgagattctgcaccaagagtgggagaaggcaggttatgcagaatattggaagtat
ttcctggagggcaattgtttgaattcactccgctcacagctgaagtacggaaaggaattt
ttgctgagaacaggtaccctgaaattacacatgacccataaggtcagagctgatgggaat
atcactctaaggtgctgggccctgaacttctaccctactgagatcaccctgacctggcag
aaggatgggagcaaccagaatctggacatggaggtgatagagaccaggccttcaggggat
gggaccttccagaagtgggcagctgtggtggtgcctcctggggaggagcagagatacaca
tgccatgtgcagcatgaagggctgcctgagcccctcaccctgagatgggagcctcctcag
gcctctgtccccatcatgccaattgttactggcctggttcttggagctgtgctaatggga
gctgtggtgacttttctgatatggaagaagaggaataaaggcaagaaaagggcagggcag
gatgatgtgggcaaagagcgtcgtgagtttcctgattcaacaaaagagagggactctcca
gagccctga

KEGG   Cricetulus griseus (Chinese hamster): 100757615
Entry
100757615         CDS       T02813                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain isoform X1
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100757615
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100757615
   04145 Phagosome
    100757615
  09143 Cell growth and death
   04218 Cellular senescence
    100757615
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100757615
   04612 Antigen processing and presentation
    100757615
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100757615
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100757615
   05330 Allograft rejection
    100757615
   05332 Graft-versus-host disease
    100757615
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100757615
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100757615
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100757615
   05170 Human immunodeficiency virus 1 infection
    100757615
   05168 Herpes simplex virus 1 infection
    100757615
   05163 Human cytomegalovirus infection
    100757615
   05167 Kaposi sarcoma-associated herpesvirus infection
    100757615
   05169 Epstein-Barr virus infection
    100757615
   05165 Human papillomavirus infection
    100757615
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100757615
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100757615
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100757615
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100757615
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig DUF4436 MHC_I_3 ECSCR
Other DBs
NCBI-GeneID: 100757615
NCBI-ProteinID: XP_027244416
LinkDB
Position
1
AA seq 397 aa
MWALIFWLLSRPRDIGARLLSRGSRLDRAPDTMWALIFWLLSCLPDIGARSHSLLYSYSA
VTKPGPQVPAFSATGFIDDQPFIRYNSDSMEAEPAVDWLREDPGYLADETQIFTNKMKIF
QLSLRNIQKYYNSSGARSQRVADGVHQQAGPHTLQFTYGCQIRDDRSTTGHWQYGYDGSD
YLALDLDSMQYVAATFIAGYTKRKWEHSEYWLERDSSYLKTECILWLHRYLALGGENFNR
TDPPQTRVTHHPRPEGDATLRCWALGFYPAEISLTWQLDTEELTQDMELVETRPSGDGTF
QKWAAVVVPSGEEQKYTCHVHHEGLPEPLTLRWEPLQHSTPIIEECTRSSGCGHTVSRNG
LVLIVVFIVVVFIIVGVACYRLKASRTLAPRHMSRQL
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgtgggctctcatcttctggctcctgagtcgcccccgggacatcggagcccgtctactt
tctcgggggagcagacttgacagagcgcctgacaccatgtgggctctcatcttctggctc
ctgagttgcctcccggacatcggagcccggtcacattctctgctgtattcctactcggct
gtgactaagccgggtccacaagtccctgcattttccgccactggcttcatagacgaccag
cctttcattcgctataacagcgacagcatggaggcagagcctgctgttgactggctgagg
gaagacccagggtaccttgctgacgagacccagatcttcaccaataagatgaagattttc
cagttgagcctgagaaacatacagaagtactacaacagctccggggcccggagtcagaga
gtagcagatggcgtccaccagcaagcaggccctcacaccctccagttcacatatggctgc
cagattcgagatgacagaagtaccacgggacactggcagtatggctatgacggcagtgac
tacctggccttggatttggactctatgcaatatgtagcagccacgttcattgctggctac
accaagcggaaatgggagcacagcgagtactggctggagagagacagcagctacctgaag
acggaatgcatactgtggctccacagatacttggccctgggaggagagaacttcaatcga
actgaccctccccagacgagagtaacccaccatcccagacctgaaggagacgccaccctg
aggtgctgggccctgggattctaccctgctgagatctcactgacctggcagttagataca
gaggaactgacccaggacatggagctggtggagacccggccttctggggacggaaccttc
cagaagtgggcagctgtggtggtgccttctggggaggaacagaaatacacatgccatgtg
caccatgaggggctgcctgagcccctcaccctgagatgggagcctcttcagcacagtacc
ccaatcatagaggagtgtactaggagcagtggatgtggacatacagtatccaggaatggc
ctcgtgcttattgtcgttttcatagtagttgtgtttattattgttggagttgcctgctac
cgtttgaaggcatcaagaactctggcacctcgtcacatgtcccggcagctgtaa

KEGG   Cricetulus griseus (Chinese hamster): 100758095
Entry
100758095         CDS       T02813                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: patr class I histocompatibility antigen, A-126 alpha chain-like isoform X2
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100758095
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100758095
   04145 Phagosome
    100758095
  09143 Cell growth and death
   04218 Cellular senescence
    100758095
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100758095
   04612 Antigen processing and presentation
    100758095
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100758095
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100758095
   05330 Allograft rejection
    100758095
   05332 Graft-versus-host disease
    100758095
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100758095
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100758095
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100758095
   05170 Human immunodeficiency virus 1 infection
    100758095
   05168 Herpes simplex virus 1 infection
    100758095
   05163 Human cytomegalovirus infection
    100758095
   05167 Kaposi sarcoma-associated herpesvirus infection
    100758095
   05169 Epstein-Barr virus infection
    100758095
   05165 Human papillomavirus infection
    100758095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100758095
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100758095
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100758095
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100758095
SSDB
Motif
Pfam: C1-set MHC_I ig Ig_3 TraL DUF2207 stn_TNFRSF12A TSP_NTD
Other DBs
NCBI-GeneID: 100758095
NCBI-ProteinID: XP_027244459
LinkDB
Position
1
AA seq 233 aa
MSGVNYILHQYEMIFNGHDCLALNEDLSTWTVVXKASEILTQEFEKKCXAKNLRPLLEGE
CVQSHLAQLDYGKEILLRTDIPKFHVTHKVRADGNITLKCWALDFYHSDITLTWQKDGSN
QNLDMEVIETRPAGDGTFQKWAAVVVPPGEEQRYTCHVNHEGLPEPLTLRWEPPQASVPI
MPIVTGLVLGAVLMGALVTFLIWKRSTKDKKMAGPEFMSLWEYQAQLRVCPAP
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctggagtgaactacatcctacatcaatatgaaatgatcttcaatggccatgattgc
cttgcactaaatgaggacctgagcacttggactgtagtttgaaaggcatctgagatcctg
acccaagagtttgagaagaaatgttaggcaaaaaatttgaggcctttactggaaggtgaa
tgtgtgcagtcacacttagctcagctggactacgggaaggaaattttgctgagaacagac
atcccgaaatttcatgtgacccataaggtcagagctgatgggaatatcactctaaagtgc
tgggccctggatttctaccattcggatatcaccctgacctggcagaaggatgggagcaac
cagaatctggacatggaggtgatagagaccaggcctgcaggagatggaaccttccagaag
tgggcagctgtggtggtgcctcctggggaggagcagagatacacatgccatgtgaaccat
gaggggctgcctgagcccctcaccctgagatgggagcctcctcaggcctcagttcccatc
atgccaattgtgactggcctggttcttggagctgtgcttatgggagctctggtgactttt
ctgatatggaagaggagtaccaaagataagaaaatggcagggcctgagttcatgtctctg
tgggaatatcaagcccagctgagagtgtgccctgccccatga

KEGG   Cricetulus griseus (Chinese hamster): 100758961
Entry
100758961         CDS       T02813                                 

Definition
(RefSeq) patr class I histocompatibility antigen, A-126 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100758961
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100758961
   04145 Phagosome
    100758961
  09143 Cell growth and death
   04218 Cellular senescence
    100758961
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100758961
   04612 Antigen processing and presentation
    100758961
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100758961
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100758961
   05330 Allograft rejection
    100758961
   05332 Graft-versus-host disease
    100758961
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100758961
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100758961
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100758961
   05170 Human immunodeficiency virus 1 infection
    100758961
   05168 Herpes simplex virus 1 infection
    100758961
   05163 Human cytomegalovirus infection
    100758961
   05167 Kaposi sarcoma-associated herpesvirus infection
    100758961
   05169 Epstein-Barr virus infection
    100758961
   05165 Human papillomavirus infection
    100758961
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100758961
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100758961
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100758961
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100758961
SSDB
Motif
Pfam: C1-set Ig_3 ig Ig_2 C2-set_2 TraL PTP_tm
Other DBs
NCBI-GeneID: 100758961
NCBI-ProteinID: XP_035306472
LinkDB
Position
1
AA seq 153 aa
MTKISNLFTSDKPQIHVTHKIRANGKITLRCLALNFYPAEITLTWQREGNNQTQGTEVMD
TRPAGDGNFQKWAAVVVLPGEEQRYTCHVQHEGLPEPLTLRWEPRQPSVPIMPIVTGLVL
GAVLMGAVVTFLIWKRRNKGKKGAGSEFVSVGI
NT seq 462 nt   +upstreamnt  +downstreamnt
atgactaaaatctccaatttattcacttcagataaaccacaaatacatgtgactcacaag
atcagagctaatgggaaaattaccctgaggtgcttggccctgaacttctaccctgctgag
atcaccctgacctggcagagggaggggaacaatcagacacagggcacagaggtgatggac
accaggcctgcaggggatgggaacttccagaagtgggcagctgtggtggtgcttcctggg
gaggagcagagatacacatgccatgtgcagcatgaggggctgcctgagcccctcaccctg
agatgggagcctcgtcagccctctgtccccatcatgccaattgttactggcctggttctt
ggagctgtgctaatgggagctgtggtgacttttctgatatggaagaggaggaataaaggt
aagaaaggggcaggatctgagttcgtgtctgtgggaatatga

KEGG   Cricetulus griseus (Chinese hamster): 100759246
Entry
100759246         CDS       T02813                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100759246
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100759246
   04145 Phagosome
    100759246
  09143 Cell growth and death
   04218 Cellular senescence
    100759246
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100759246
   04612 Antigen processing and presentation
    100759246
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100759246
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100759246
   05330 Allograft rejection
    100759246
   05332 Graft-versus-host disease
    100759246
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100759246
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100759246
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100759246
   05170 Human immunodeficiency virus 1 infection
    100759246
   05168 Herpes simplex virus 1 infection
    100759246
   05163 Human cytomegalovirus infection
    100759246
   05167 Kaposi sarcoma-associated herpesvirus infection
    100759246
   05169 Epstein-Barr virus infection
    100759246
   05165 Human papillomavirus infection
    100759246
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100759246
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100759246
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100759246
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100759246
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2
Other DBs
NCBI-GeneID: 100759246
NCBI-ProteinID: XP_027244425
LinkDB
Position
1
AA seq 335 aa
MGAMTPRTLLLLLAAALAPTQTPAGSHSLRYFGTAMTQPGHGEPRFVAFGFVDDTRFVWF
DSDAVTPREEPRARWMEEKRPEYWERQTRIAKANAQIFRDNLRTLLRYYNQSEAGYHTIQ
SMRGCYMGSDGRFLGGYYRTAYDGADHISLNEDLRSWTAANKVALITQRKYEATNEAEHH
RAYLKVTCMEWLRSHLEKGKEILQRADPPKTHLTHHPRPEGDITLKCWALGFYPADITLT
WQRDRKEQTQDMELVDTRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWAP
PPQHIDLIVGVAAGLVLLGAAVTAVVWRKLPRRNV
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgggggcgatgacgccgcgcacgctgctcctgctgctggcggccgccctggccccgacc
cagacgcccgcgggctcgcactcgctgcgttatttcggcactgccatgacccagccggga
cacggggaaccgcggttcgtcgccttcgggttcgtggacgacacgcgctttgtgtggttc
gacagcgacgcggtcacccccagagaggagccgcgggcgcggtggatggaggagaagcgg
ccggagtactgggagcggcagactcggatcgccaaagcaaacgcgcagattttccgtgat
aatctgaggaccctgctgcgctactacaaccagagcgaagcagggtaccacaccatccag
tccatgcgtggctgctatatgggcagtgatgggcgcttcctcggcgggtactacaggacg
gcgtatgatggcgccgaccacatctctctaaacgaggacctccgttcctggactgctgcc
aacaaggtggctctgattacccagcgcaagtacgaggcaacgaatgaggcggagcaccac
agggcctacctgaaagttacatgcatggagtggctccgcagtcatctggagaaggggaaa
gagatactgcaacgtgcagatcccccaaagacacacttgacccatcatcccagacctgaa
ggtgacatcaccctgaagtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagagagataggaaggaacagacccaggacatggaacttgtggacaccaggcctgca
ggggacggaaccttccagaagtgggcggctgtggtggtaccttctggggaggagcagaga
tacacatgccatgtgcagcatgaggggctgcctgagcccctcaccctgagatgggcccca
cctcctcagcacatagacctcattgtgggagtcgctgctgggctggttctccttggagct
gcggtcactgctgtggtgtggagaaagttaccaaggaggaatgtgtga

KEGG   Cricetulus griseus (Chinese hamster): 100761901
Entry
100761901         CDS       T02813                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: H-2 class I histocompatibility antigen, Q10 alpha chain isoform X2
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100761901
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100761901
   04145 Phagosome
    100761901
  09143 Cell growth and death
   04218 Cellular senescence
    100761901
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100761901
   04612 Antigen processing and presentation
    100761901
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100761901
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100761901
   05330 Allograft rejection
    100761901
   05332 Graft-versus-host disease
    100761901
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100761901
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100761901
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100761901
   05170 Human immunodeficiency virus 1 infection
    100761901
   05168 Herpes simplex virus 1 infection
    100761901
   05163 Human cytomegalovirus infection
    100761901
   05167 Kaposi sarcoma-associated herpesvirus infection
    100761901
   05169 Epstein-Barr virus infection
    100761901
   05165 Human papillomavirus infection
    100761901
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100761901
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100761901
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100761901
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100761901
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 ig
Other DBs
NCBI-GeneID: 100761901
NCBI-ProteinID: XP_035305206
LinkDB
Position
9
AA seq 381 aa
MAPRHALLLLLVAALAPTQTRAGSHSLRNFYTMVSGPGEPRFIVVGYVDDTQFVRFDSDA
ETPRYEPRVLWLRKEWPEYWERNTRKAKDSEQIFRASLRTLLGYYNQSEGGSHTIQLMYG
CHVGPDGRLLRGYHQYAYDGDDYIALNDDLRTWTAADTAAQITRRKLQQAGATERFRAYL
EGECVQWLRRHLENGKDQLMRTDPPKAHVTHHPGSKGDATLRCWALGFYPAVITLIWQKE
EEEQTQDMELVETRPSGDGTFQKWASLVVPSGEEQKYTCHVHHEGLPEPLTLRWEPPPQS
TVPIMVEKEGTMLPLQPTLLFRQTAGAISDLSPPCRPELQALTSPLEIRTWRDGSEVKGT
GCSSRGPEFIPSNHRVAHNHL
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggcgccgaggcacgcgctgctcctgctgctggtggccgccctggccccgacccagacc
cgcgcgggctcgcactcgctgaggaatttctacaccatggtgtccgggccgggggagccc
cggttcattgtcgtcggttacgtggacgacacccagttcgtgcgcttcgacagcgacgcg
gagacccccaggtacgagccgcgggtgctgtggctgcggaaggagtggccggagtattgg
gagaggaacacgcggaaagccaaggacagcgagcagatcttccgagcgagcctcaggacc
ctgctcggctactacaaccagagcgagggcggctctcacaccatccagctcatgtacggc
tgtcacgtggggccggacgggcgcctcctccgcgggtaccatcagtacgcctacgacggc
gacgattacatcgccctgaacgacgacctgaggacctggacggctgcggacaccgcggcg
cagatcacccggcgcaagctgcagcaggctggcgctaccgagagattccgggcctacctg
gagggcgagtgcgtgcagtggctccgcaggcacctggagaacgggaaggaccaactgatg
cgcacagatcccccaaaggcacatgtcacccatcatcccggatctaaaggcgatgccacc
ctgaggtgctgggccctgggcttctaccctgctgtcatcaccctgatctggcagaaggag
gaggaagaacagactcaggacatggagctggtggagaccagaccttctggggatggaacc
ttccagaagtgggcatctctggtggtgccttctggggaggagcagaaatacacatgccat
gtgcaccatgaggggctgcccgagcccctcaccctgagatgggagcctcctcctcagtcc
actgtccccatcatggtggaaaaggagggaactatgctcccgctccagccaacccttctg
ttccggcagacagcaggggccatctccgacctgtcacctccatgccgccctgagttgcag
gccctgacttccccactggaaataaggacctggagagatggctcagaggttaagggcact
ggctgttcttccagaggtcctgagttcattcccagcaaccacagggtggctcacaaccat
ctgtaa

KEGG   Cricetulus griseus (Chinese hamster): 100762478
Entry
100762478         CDS       T02813                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain isoform X2
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100762478
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100762478
   04145 Phagosome
    100762478
  09143 Cell growth and death
   04218 Cellular senescence
    100762478
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100762478
   04612 Antigen processing and presentation
    100762478
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100762478
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100762478
   05330 Allograft rejection
    100762478
   05332 Graft-versus-host disease
    100762478
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100762478
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100762478
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100762478
   05170 Human immunodeficiency virus 1 infection
    100762478
   05168 Herpes simplex virus 1 infection
    100762478
   05163 Human cytomegalovirus infection
    100762478
   05167 Kaposi sarcoma-associated herpesvirus infection
    100762478
   05169 Epstein-Barr virus infection
    100762478
   05165 Human papillomavirus infection
    100762478
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100762478
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100762478
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100762478
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100762478
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 Ig_2 Yip1 ig Psg1 Darcynin
Other DBs
NCBI-GeneID: 100762478
NCBI-ProteinID: XP_027244409
LinkDB
Position
1
AA seq 445 aa
MQCPRRPHALTGTATAPVSVNIYFKCSVYFTWHRHAVGLGRFRDTGTNSAQSTAQDTDDS
AVLTPIGEIPGNQPASPRAPADCGTGHSDLRWGVMAPRTLLLLLAAALAPTQTRAGSHSL
RYFYTIESRPGLGEPRFISVGYVDDTQFVRFDSDAENPRYEPRAPWMEREGPEYWERSTR
RAKDRQQIFRVNLRTAIGYYNQSKGGSHTFQRMSGCHMGSDGRLLRGYDQFAYDGDDYIA
MNDDLRTWTAADMAAQITLRKWEQAGVALHQRAYLEGECLEWLSRHLEHGKDQLLRTDPP
KTHVTHHPRPEGKVTLKCWALGFYPADITLTWMKDEEELTQYMELVETRPSGDGTFQKWA
AVEVPVGEEQKYTCHVEHEGLPEPLTLRWEPPQSTITIMTIAGAVLGAVILVCIIGGVMM
WMKKNSGGEGVFAPAACQQDQCPEV
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgcagtgtccacggcggccccacgcactcaccgggactgcgacagcacctgtttccgtg
aacatttattttaagtgttctgtgtattttacctggcatcgtcatgcagttggccttggg
cggttcagagacaccgggacaaacagcgctcagtccacagcacaggacacagatgactcg
gcggttctcacccccattggtgagatcccggggaaccaaccagcgtcgccgcgggccccg
gcagactgcggaaccggacactcagatctaagatggggtgtgatggcgccgcgcacgctg
ctcctgctgctggcggccgccctggccccgacccagacccgcgcgggctcgcactcgctg
cggtatttctacaccatcgagtcccggcccggcctcggggagccccggttcatctctgtc
ggctacgtggacgacacgcagttcgtgcgcttcgacagcgacgccgagaatccgagatac
gagccgcgggcgccttggatggagagggaggggccagagtattgggagaggagcacacgg
agagccaaggacaggcagcagattttccgagtgaacctgaggaccgcgatcggctactac
aaccagagcaagggcggctctcacaccttccagcggatgtctggctgtcacatggggtcg
gacgggcgcctcctccgtgggtatgatcagttcgcctacgatggcgatgattacatcgcc
atgaacgacgacctgaggacgtggactgcagcagacatggcagcacagatcaccctgcgc
aagtgggagcaggctggtgttgcactgcatcaaagggcctacctggagggcgagtgcctg
gagtggctcagcagacacctggagcacgggaaggaccagctgctgcgcacagaccctcca
aagacacatgtgacccatcaccccagacctgaaggtaaagtcaccctgaagtgctgggcc
ctgggattctaccctgctgacatcaccctgacctggatgaaggatgaggaggaactgaca
cagtacatggagctggtggagaccagaccttctggggatggaaccttccagaagtgggca
gctgtggaggtgcctgttggagaggagcagaaatacacatgccatgtggagcatgagggg
ctgcctgagcccctcaccctgagatgggagcctcctcagtcaaccatcaccatcatgacc
attgctggtgctgtcctcggagctgtgatcttagtttgtatcattggaggtgttatgatg
tggatgaaaaagaactcaggtggagaaggagtctttgcccctgctgcatgtcaacaggac
cagtgcccagaggtctga

KEGG   Cricetulus griseus (Chinese hamster): 100762763
Entry
100762763         CDS       T02813                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: H-2 class I histocompatibility antigen, Q10 alpha chain-like isoform X2
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100762763
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100762763
   04145 Phagosome
    100762763
  09143 Cell growth and death
   04218 Cellular senescence
    100762763
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100762763
   04612 Antigen processing and presentation
    100762763
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100762763
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100762763
   05330 Allograft rejection
    100762763
   05332 Graft-versus-host disease
    100762763
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100762763
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100762763
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100762763
   05170 Human immunodeficiency virus 1 infection
    100762763
   05168 Herpes simplex virus 1 infection
    100762763
   05163 Human cytomegalovirus infection
    100762763
   05167 Kaposi sarcoma-associated herpesvirus infection
    100762763
   05169 Epstein-Barr virus infection
    100762763
   05165 Human papillomavirus infection
    100762763
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100762763
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100762763
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100762763
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100762763
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 Psg1 EphA2_TM MHC_I_3 ASFV_J13L ig
Other DBs
NCBI-GeneID: 100762763
NCBI-ProteinID: XP_035306826
LinkDB
Position
1
AA seq 361 aa
MGRWRRALLLLLAAALAPSQTRAGSHSLRYFSTFVSRPGLGEPRYMEVGYVDDTQFVRFD
SDAENPRMEPRAPWMEREGPEYWERETWRAKDWEQDFRLYLRTALGYYNQSEGGSHTYQV
CVCGCDMGSDGRLLHGYEKHAYEGRDYLVLNEDLRTWTVADPAVQITQHMLQQDGYEERY
RAYLEDECLKSLRRYLENGKDQLLRTDPPKAHVTHHPGPKGDVTLRCWAMGFYPAEITLT
WQREEEEQTQDMELVETRPSGDGTFQKWAAVVVPSGEEQKYTCHVYPEGLPEPLTLRWEP
PPQSTVPIMAVIAVLVLLVTIITAVVAVSRKKRRNTGVQDEDSKTHKNELILMLAAGDSG
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggggcgatggcgccgcgcgctgctcctgctgctggcggccgccctggccccgagccag
acccgcgcgggctcgcactcgctgcggtatttctccaccttcgtctcccggcccggcctc
ggggagcccaggtacatggaagtcggctacgtggacgacacgcagttcgtgcgcttcgac
agcgacgcggagaatccgagaatggagccgcgggcgccgtggatggagcgggaggggccg
gagtattgggagagggagacatggagagccaaggactgggagcaggatttccgattgtac
ctgaggacagcgcttggctactacaaccagagcgagggcggttcccacacctaccaggtg
tgtgtgtgtggctgtgacatggggtcagatgggcgcctcctccatgggtatgagaagcac
gcctacgagggccgcgattaccttgtcctgaacgaggacctgaggacgtggaccgtggcg
gacccggcggtgcagatcacccagcacatgttacagcaggatggttatgaagaaagatac
agggcctacctggaggacgagtgcttgaagtctctccgcagatacctggagaacgggaag
gaccagctgctgcgcacagatcccccaaaggcacatgtgacccatcatcctggacctaaa
ggtgatgtcaccctgaggtgctgggccatgggcttctaccctgctgagatcaccctgact
tggcagagggaggaggaagaacagactcaggacatggagctggtggagaccagaccttct
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggggaggagcagaaa
tacacatgccatgtgtaccctgaggggcttcctgagcccctcaccctgagatgggagcct
cctcctcagtccactgtccccatcatggcagtcattgctgttctggttctccttgtgacc
atcattacagctgtggtggctgtttcgaggaagaagaggagaaacacgggtgtccaggat
gaagactcaaagacacataagaatgaattaatccttatgttggctgcaggggactctggc
ctctaa

KEGG   Cricetulus griseus (Chinese hamster): 100771128
Entry
100771128         CDS       T02813                                 

Definition
(RefSeq) class I histocompatibility antigen, Gogo-B*0102 alpha chain-like isoform X2
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100771128
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100771128
   04145 Phagosome
    100771128
  09143 Cell growth and death
   04218 Cellular senescence
    100771128
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100771128
   04612 Antigen processing and presentation
    100771128
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100771128
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100771128
   05330 Allograft rejection
    100771128
   05332 Graft-versus-host disease
    100771128
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100771128
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100771128
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100771128
   05170 Human immunodeficiency virus 1 infection
    100771128
   05168 Herpes simplex virus 1 infection
    100771128
   05163 Human cytomegalovirus infection
    100771128
   05167 Kaposi sarcoma-associated herpesvirus infection
    100771128
   05169 Epstein-Barr virus infection
    100771128
   05165 Human papillomavirus infection
    100771128
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100771128
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100771128
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100771128
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100771128
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_3 ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 100771128
NCBI-ProteinID: XP_027244477
LinkDB
Position
1
AA seq 343 aa
MGTAVLSATLLLLSLLLALTQTKTQSLAGSHSLSYSVTTMASLRGLGDPQVFAVGYVDNT
QILSFNSEAIVEPRVPWAKQMGRDYWRLERESLEYYAHTAIENLRFAIQIYNKSDDGSHT
FQCFIGCDVGPHRRLLRGHNRYAFDGRDYISLNEDLRTWTVADKTAQNIQREWEKKNVAL
DIGIFLGGRCVPWLLWHLELGKEILQRSDPPKAHVTHHPTPEGDVTLRCWALGFYPAEIT
LTWQRDGKDQTQDMELVDTRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPEPLTLRW
ELPPWLTIGITVGVVLLGVVVTGAVAAIVMMRKKSAGKEGIGV
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggggacagcagtgctgtctgctaccctcctgctgctctcgctactcctggctctgacc
cagaccaagacccagagcctagctgggtctcactcgctgagctattctgttaccacgatg
gcatctctaaggggtcttggagatccccaagtcttcgctgttggctatgtggacaacacg
caaatcctgagcttcaacagtgaggctatcgtggagccgcgcgtgccatgggcaaagcaa
atggggcgcgattattggaggttggagagagagagtctggagtattatgcacatacagcc
atagaaaacttgcgatttgcaatccagatctataacaagagtgatgacggctctcatacc
tttcagtgtttcattggttgtgatgtgggtccacaccgacgcctcctccgtgggcacaat
agatatgcctttgatggccgcgattacatcagcctgaacgaggacctgagaacttggact
gtggcagacaagacagctcagaacatccagcgagagtgggagaaaaaaaacgtagcattg
gacataggcatcttcttggggggccggtgtgttccttggctactttggcacctggagcta
gggaaggagattctgcaacgctcagaccctccaaaggcacatgtaacccatcaccctaca
cctgaaggtgatgtcaccttgaggtgctgggccctgggattctacccagctgagatcacc
ctgacctggcagagggatggaaaagaccagacccaggacatggagctggtggacaccagg
cctgcaggagatggaaccttccagaagtgggcagctgtggtggtgcctcctggggaggag
cagagatacacatgccatgtgcagcatgagggtctgcctgagcccctcaccctgagatgg
gagctacctccttggctcacaattggaataactgttggtgtggttctccttggagttgtg
gtcactggagctgtggctgccattgtgatgatgaggaagaaaagtgcaggtaaggaaggc
attggtgtctga

KEGG   Cricetulus griseus (Chinese hamster): 100772658
Entry
100772658         CDS       T02813                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, alpha chain F
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100772658
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100772658
   04145 Phagosome
    100772658
  09143 Cell growth and death
   04218 Cellular senescence
    100772658
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100772658
   04612 Antigen processing and presentation
    100772658
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100772658
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100772658
   05330 Allograft rejection
    100772658
   05332 Graft-versus-host disease
    100772658
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100772658
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100772658
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100772658
   05170 Human immunodeficiency virus 1 infection
    100772658
   05168 Herpes simplex virus 1 infection
    100772658
   05163 Human cytomegalovirus infection
    100772658
   05167 Kaposi sarcoma-associated herpesvirus infection
    100772658
   05169 Epstein-Barr virus infection
    100772658
   05165 Human papillomavirus infection
    100772658
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100772658
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100772658
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100772658
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100772658
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3 Ig_2
Other DBs
NCBI-GeneID: 100772658
NCBI-ProteinID: XP_027244483
LinkDB
Position
1
AA seq 373 aa
MKSFVLEALLLLILGNLVMSRHPEGSHSLTYLQTLLTWPDPLASHFIGSAYLDDIHIERL
NTITQTPKLEHCAPWLDQQQPEYWEQSTLGMLNLRDFYKRLLKKVLHIYNQSETGYHTVQ
FRMSCDVLPGVNYIRGQYEMIFNGHDYIALNEDLTTWTAVGKAAEVLSQEFEKKSYAKNL
RPLLEGECVQSLLAQLDYGKEILLRKDIPKLHVTHKVRADGNITLRCWAQDFYHAEITLT
WQKDGSNQNLDMEVIETRPAGDGTFQKWAAVVVPPGEEQRYTCHVNHEGLPESITLRWEP
PQPSVPIMPIVTGLVLGAVLMGAVVTFLIWKWRSKGKKRSGVYLQAFHNGTGHGGCMSLI
PALQKKRHKYQEI
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaagtcctttgttctggaggctctccttctactgatcctgggcaacctcgtcatgtcc
aggcatccagagggctcacactccctgacctatttgcaaaccctgctcacctggcctgac
cccctggcgtctcacttcattggttctgcctacttggatgacattcatattgagagactc
aacaccataacacagactccgaagctggagcactgtgcaccatggttggatcagcagcag
ccagagtattgggagcaatcgactctgggcatgctgaatctaagagacttctacaagcgc
cttctgaagaaagtgcttcacatctacaatcaaagtgaaactggatatcacacagtgcag
ttccgaatgtcctgtgatgtgctgcctggagtgaactacatccgtggacaatatgaaatg
atcttcaatggccatgattacattgcactaaatgaggacctgaccacttggactgcagtc
ggaaaggccgctgaagtcctgagccaagagttcgagaagaaaagttatgccaaaaatttg
aggcctttactggaaggtgaatgtgtgcagtccctcttagctcagctggactacgggaag
gaaattttgctgagaaaagacatcccgaaattacatgtgacccataaggtcagagctgat
gggaatatcactctaaggtgctgggcccaggatttctaccatgctgagatcaccctgacc
tggcagaaggatgggagcaaccagaatctggacatggaggtgatagagaccaggcctgct
ggggatgggaccttccagaagtgggcagctgtggtggtgcctcctggggaggagcagaga
tacacatgtcatgtgaaccatgaggggctgcctgagtccatcaccctgagatgggagcct
cctcagccctctgtccccatcatgccaattgtgactggcctggttcttggagctgtgctt
atgggagctgtggtgacttttctgatatggaagtggaggagtaaaggtaagaaaaggtca
ggtgtatatttacaagcttttcacaatgggacaggacatggtggctgcatgtctctaatc
ccagcacttcaaaagaagaggcataaatatcaggagatctag

KEGG   Cricetulus griseus (Chinese hamster): 100772949
Entry
100772949         CDS       T02813                                 

Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain isoform X2
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100772949
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100772949
   04145 Phagosome
    100772949
  09143 Cell growth and death
   04218 Cellular senescence
    100772949
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100772949
   04612 Antigen processing and presentation
    100772949
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100772949
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100772949
   05330 Allograft rejection
    100772949
   05332 Graft-versus-host disease
    100772949
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100772949
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100772949
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100772949
   05170 Human immunodeficiency virus 1 infection
    100772949
   05168 Herpes simplex virus 1 infection
    100772949
   05163 Human cytomegalovirus infection
    100772949
   05167 Kaposi sarcoma-associated herpesvirus infection
    100772949
   05169 Epstein-Barr virus infection
    100772949
   05165 Human papillomavirus infection
    100772949
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100772949
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    100772949
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   100772949
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  100772949
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 ig C2-set_2 MHC_I_3 Ig_2
Other DBs
NCBI-GeneID: 100772949
NCBI-ProteinID: XP_035307307
UniProt: A0A061INJ1
LinkDB
Position
1
AA seq 332 aa
MLFFQTLLTWDGFVEYQYTYLGYVDDTLFMGYNSRTDKPRMKPHAPWMHQETPQFWEYET
QRALNLTKQLTEELKAVLHIYNQSKTGYHTVQMIHGCTVLPGGYFGGGYYEVIYDGRDYI
ALNEDLSTWTAVGMAAKIIRYQWKILGTAELVKTYLENSCMYDLQKHLENGKEILLRTDP
PLTDVTHKVSTDGNTTLRCWALNFYPAEITLTWQTDGNNLTQDMEVIETRPSGNGTFQKW
AAVVVPPGEEQRYTCHVHHEGLPEPLTLRWVPSSEPSVPIMPVVTGLVLGAVLMGAMVTF
LIWKRRNKDKKGAGSEATSLSDSNRGLSFIVL
NT seq 999 nt   +upstreamnt  +downstreamnt
atgctgtttttccaaaccctcctaacctgggacgggtttgtggagtaccagtacacctac
cttggttatgtggacgacaccctgttcatgggatacaacagcagaaccgacaagccaagg
atgaaaccccatgctccctggatgcatcaggagacaccacagttttgggagtatgagaca
cagagagctttgaatctcacaaagcaattgacagaagaactgaaagcagtgctccacatt
tacaaccagagcaaaaccggatatcacacagtccagatgatccatggatgtacggtgctg
cctggagggtacttcggtggcggatactacgaagtaatctatgatggccgagattacatt
gccctgaacgaggacctgagcacctggacagcggttggcatggcagcaaaaatcatcagg
tatcagtggaagatactgggtacagcagaactcgtgaagacatacctagagaacagctgc
atgtacgatctccaaaaacaccttgagaatgggaaggagattttgctgagaacagacccc
cccctaacagatgtgactcataaggtgagcactgatgggaataccaccctgaggtgctgg
gccctgaacttctaccctgctgagatcaccctgacctggcagacagatgggaacaatctg
acacaggacatggaggtgatagaaaccaggccttcaggaaatgggacctttcagaagtgg
gcagctgtggtggtgcctcctggggaggagcagagatacacatgccatgtgcaccatgag
gggctgcctgagcccctcaccctgagatgggttccatcttcagagccctctgtccccatc
atgccagttgttactggcctggttcttggagctgtgcttatgggagctatggtgactttt
ctgatatggaagaggaggaataaagataagaaaggggcaggatctgaggccacctcactt
tctgacagcaacagggggttgtctttcattgtcctttaa

KEGG   Cricetulus griseus (Chinese hamster): 103158895
Entry
103158895         CDS       T02813                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    103158895
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103158895
   04145 Phagosome
    103158895
  09143 Cell growth and death
   04218 Cellular senescence
    103158895
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103158895
   04612 Antigen processing and presentation
    103158895
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103158895
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103158895
   05330 Allograft rejection
    103158895
   05332 Graft-versus-host disease
    103158895
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103158895
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103158895
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103158895
   05170 Human immunodeficiency virus 1 infection
    103158895
   05168 Herpes simplex virus 1 infection
    103158895
   05163 Human cytomegalovirus infection
    103158895
   05167 Kaposi sarcoma-associated herpesvirus infection
    103158895
   05169 Epstein-Barr virus infection
    103158895
   05165 Human papillomavirus infection
    103158895
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    103158895
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    103158895
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   103158895
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  103158895
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig EphA2_TM C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 103158895
NCBI-ProteinID: XP_027247612
LinkDB
Position
1
AA seq 364 aa
MGAVAPRTLLLLLAAALAPTQTRAGSHSLRYFYTTVFRPGLGEPRFIYVGYVDDTQFVRF
DSDAENPSMEPRAPWMEREGPEYWQRETRIAKDREQIYRVNLRTLLGYYNQSEDSSHTIQ
SMYGCHVGSDGRLLRGYSQIAYDGNDYIALNEDLRTWTAADTAAQITQRKWEQAGDADRY
RAYLEGTCVEWLRRYLEHGKDQLLRTDPPKAHVTHHPGSKGDVTLRCWALGFYPADITLT
WQREEEEQTQDMELVETRPSGDGTFQKWASLVVPSGEEQKYTCHLHHEGLPEPLTLRWEP
PPQSTVLIMAVIAALVLIGAVIIGAVVFFVRKRRNSGGKGGNYAPTPGRDSSQSSDVSLS
DCKA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgggggcggtggccccgcgcacgctgctcctgctgctggcggccgccctggccccgacc
cagacccgcgcgggctcgcactcgctgaggtatttctacaccaccgtgttccggcccggc
ctcggggagccccggttcatctatgtcggctacgtggacgacacgcagttcgtgcgcttc
gacagcgacgccgagaatccgagtatggagccgcgggcgccgtggatggagcgggagggg
ccggagtattggcagagggagacgcggatcgccaaggacagagagcagatttaccgagtg
aacctgaggaccctgctcggctactacaaccagagcgaggacagctctcacaccatccag
agtatgtacggctgtcacgtggggtcggacgggcgcctcctccgcgggtacagtcagatc
gcctacgatggcaacgattacatcgccctgaacgaggacctgaggacgtggacggcggcg
gacacggcggcgcagatcacccagcgcaagtgggagcaggctggtgatgcagacagatac
agggcctacctggagggcacgtgcgtggagtggctccgcagatacctggagcacgggaag
gaccagctgctgcgcacagatcccccaaaggcacatgtgacccatcatcctggatctaaa
ggtgatgtcaccctgaggtgctgggccctgggcttctaccctgctgacatcaccctgacc
tggcagagggaggaggaagaacagactcaggacatggagctggtggagaccagaccttct
ggggatggaaccttccagaagtgggcatctctggtggtgccttctggggaggagcagaaa
tacacatgccatttgcaccatgaggggctgcctgagcccctcaccctgagatgggagcct
cctcctcagtccactgtcctcatcatggcagtcattgctgctctggttctcattggagct
gtgatcattggagctgtggtgttttttgtgaggaagaggagaaactcaggtggaaaagga
gggaactatgctccaactccaggcagggacagttcccagagctcggatgtgtctctctca
gattgtaaagcatga

KEGG   Cricetulus griseus (Chinese hamster): 103162117
Entry
103162117         CDS       T02813                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, K-D alpha chain
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    103162117
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103162117
   04145 Phagosome
    103162117
  09143 Cell growth and death
   04218 Cellular senescence
    103162117
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103162117
   04612 Antigen processing and presentation
    103162117
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103162117
  09163 Immune disease
   05320 Autoimmune thyroid disease
    103162117
   05330 Allograft rejection
    103162117
   05332 Graft-versus-host disease
    103162117
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103162117
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103162117
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103162117
   05170 Human immunodeficiency virus 1 infection
    103162117
   05168 Herpes simplex virus 1 infection
    103162117
   05163 Human cytomegalovirus infection
    103162117
   05167 Kaposi sarcoma-associated herpesvirus infection
    103162117
   05169 Epstein-Barr virus infection
    103162117
   05165 Human papillomavirus infection
    103162117
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    103162117
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    103162117
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   103162117
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  103162117
SSDB
Motif
Pfam: MHC_I C1-set ig C2-set_2
Other DBs
NCBI-GeneID: 103162117
NCBI-ProteinID: XP_027244463
LinkDB
Position
1
AA seq 300 aa
METSLLCTLHLLLGASLALTQTFEGSHSLRYFDIAVSRPGLEETLYMTAGYVENTEFVHF
NSATVNPRFEPRVPWMEQVGQEYWDDQTHIAKSAKQQIRACFQKLQGYYNQSQNSPHTIQ
RMTGCYIGHDGHLFHAYRQFGYDGEDYLTLNEDLSTWIAADTAAKITKQQWVATNEAEFW
RVYLQGPCVVWLLKYPKMGSEILLRTDPPKAYVTHHPRPEGDITLRCWALSFYPADTTLT
WQRDGEDQTQDMELVETRPSGDGTFQKWAVVVVPSREEQRYTCHVHHEGLPEPLTLRWSK
NT seq 903 nt   +upstreamnt  +downstreamnt
atggagacttcattactctgtactctccacctgctactgggggcttcccttgcccttacc
cagacctttgagggttcccactccttgcggtacttcgacatcgcagtgtcaagacctggc
ctagaagagaccctctacatgaccgcgggctatgtggaaaacacagagttcgtgcacttc
aacagtgcgacagtgaatccaaggtttgagcccagggtgccctggatggagcaggtggga
caggaatactgggatgaccagacacacattgccaagagtgcaaaacagcagattcgagcg
tgctttcagaaactgcaaggctactacaaccagagccagaacagtcctcacaccatccaa
aggatgactggctgctacattggacatgacgggcacctatttcatgcataccgtcagttt
ggctatgatggggaagattacctcaccctgaacgaggatctgagcacctggattgctgca
gacaccgcggctaagatcaccaagcaacagtgggtggcaactaatgaggctgagttctgg
agggtctacttgcagggcccttgcgtggtgtggctccttaaatacccgaagatgggaagt
gagattctactgcgcacagatccccccaaagcatatgtaactcatcaccccagacctgaa
ggggacatcaccctgaggtgctgggctctgagcttctaccctgctgacaccaccctgacc
tggcagagggatggggaggaccagactcaggatatggagcttgtggagaccaggccttct
ggggatggaaccttccagaagtgggcagttgtggtggtgccttctagggaggagcagaga
tacacatgccatgtgcaccatgaggggctgcctgagcccctcaccctgagatggagtaag
tag

KEGG   Cricetulus griseus (Chinese hamster): 113832472
Entry
113832472         CDS       T02813                                 

Definition
(RefSeq) class I histocompatibility antigen, Gogo-A*0101 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    113832472
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113832472
   04145 Phagosome
    113832472
  09143 Cell growth and death
   04218 Cellular senescence
    113832472
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113832472
   04612 Antigen processing and presentation
    113832472
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113832472
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113832472
   05330 Allograft rejection
    113832472
   05332 Graft-versus-host disease
    113832472
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113832472
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113832472
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113832472
   05170 Human immunodeficiency virus 1 infection
    113832472
   05168 Herpes simplex virus 1 infection
    113832472
   05163 Human cytomegalovirus infection
    113832472
   05167 Kaposi sarcoma-associated herpesvirus infection
    113832472
   05169 Epstein-Barr virus infection
    113832472
   05165 Human papillomavirus infection
    113832472
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    113832472
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    113832472
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   113832472
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  113832472
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3 Ig_2 TraL C2-set_2
Other DBs
NCBI-GeneID: 113832472
NCBI-ProteinID: XP_027244481
LinkDB
Position
1
AA seq 238 aa
MSCDVLPGSNYIHGQYEIIINGLDYIALNEDLSTWTAVGKAAEILTQQWEKIGHTKTLRP
FLEGECVQRLHSHLDYGKEILLRRDTPKLHVTHKVRADGTITLRCWALDFYPTEITLTWQ
KDGSNQNLDMEVIETRPAGDGTFQKWAAVVVPPGEEQSYTCHVNHEGLPEPLTLRWEPPQ
PSVPIMPIVIGLILGAVLMGAVVTFLIRKWRNKGKKRAGPEFVSLWEYQAQLKMCPAS
NT seq 717 nt   +upstreamnt  +downstreamnt
atgtcctgtgatgtgctgcctgggtcaaactacattcatggacaatatgaaattatcatc
aatggccttgattacattgcactaaatgaggacctgagcacctggactgcagttggaaag
gcagctgagatcctgacccagcagtgggagaagataggtcatacaaaaactttgaggcct
ttcctggaaggtgaatgtgtgcagcggctccactcacatctggactatgggaaggagatt
ttgctgagaagagacactccaaaactccatgtgacccataaggtcagagctgatgggact
atcactctaaggtgctgggccctggatttctaccctactgagatcaccctgacctggcag
aaggatgggagcaaccagaatctggacatggaggtgatagagaccaggcctgcaggggat
gggaccttccagaagtgggcagctgtggtggtgcctcctggggaggagcagagctacaca
tgccatgtgaatcatgaggggctgcctgagcccctcaccctgagatgggagcctcctcag
ccctctgttcccatcatgccaattgtgattggcctgattcttggagctgtgcttatggga
gctgtggtgacttttctgatacgaaagtggaggaataaaggtaagaaaagggcagggcct
gagttcgtgtctctatgggaatatcaagcccagctgaaaatgtgccctgcctcatga

KEGG   Cricetulus griseus (Chinese hamster): 113832473
Entry
113832473         CDS       T02813                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, alpha chain F-like
  KO
K06751  MHC class I antigen
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04144  Endocytosis
cge04145  Phagosome
cge04218  Cellular senescence
cge04514  Cell adhesion molecules
cge04612  Antigen processing and presentation
cge04940  Type I diabetes mellitus
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05203  Viral carcinogenesis
cge05320  Autoimmune thyroid disease
cge05330  Allograft rejection
cge05332  Graft-versus-host disease
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    113832473
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113832473
   04145 Phagosome
    113832473
  09143 Cell growth and death
   04218 Cellular senescence
    113832473
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    113832473
   04612 Antigen processing and presentation
    113832473
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    113832473
  09163 Immune disease
   05320 Autoimmune thyroid disease
    113832473
   05330 Allograft rejection
    113832473
   05332 Graft-versus-host disease
    113832473
  09166 Cardiovascular disease
   05416 Viral myocarditis
    113832473
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    113832473
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113832473
   05170 Human immunodeficiency virus 1 infection
    113832473
   05168 Herpes simplex virus 1 infection
    113832473
   05163 Human cytomegalovirus infection
    113832473
   05167 Kaposi sarcoma-associated herpesvirus infection
    113832473
   05169 Epstein-Barr virus infection
    113832473
   05165 Human papillomavirus infection
    113832473
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    113832473
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
    113832473
Exosome [BR:cge04147]
 Exosomal proteins
  Proteins found in most exosomes
   113832473
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cge00537]
 Antigens
  113832473
SSDB
Motif
Pfam: MHC_I C1-set ig Ig_3
Other DBs
NCBI-GeneID: 113832473
NCBI-ProteinID: XP_027244482
LinkDB
Position
1
AA seq 381 aa
MKIFVPEAFLLLILGNLAITRHPEGLQEQHRILGGKSRSKGKLHLGSHSLCYVYTLLTTP
DLLEPQFTFGVYLDGILIERLNTRRASPRMEHCAPWEDQQHPQYWEKATDDIFYRREVYK
RLLQRVLHIYNQSETGYHTVQVLMGCEELPGLSYIQGQYEMIFNGHDHLALNEDLSTWTA
VGKAAEILTQEWEKEGYAQHLKSFLERYCVNSLHSQLYYGKEFLLRTDIPKLHVTHKVRA
DGNVTLRCWALEFYHTEITLTWQRDGNNQTLDMEVIETRPAGDGTFQKWAAVVVLPGEEQ
RYTCHVNHEGLPEPLTLRWEPPQPSVPIMLILTGLVLGAVLMGAVVTFLIWIKRTKGKKR
AGSEFVSLWEYEAQLRVCPAT
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgaagatttttgttcctgaggctttcctgctgctgatcctgggcaatctcgccataacc
aggcatccagagggactgcaggagcagcataggatactgggtgggaagtctaggtctaaa
ggcaaactgcacttaggttcacactccctgtgctatgtctacactcttctcaccacgccc
gacctcctggagccccaattcacctttggggtctacttggatggcattcttattgagaga
ctcaacaccagaagagcgagtccgaggatggagcactgtgctccttgggaggatcagcag
cacccacagtattgggagaaagcgactgatgatatcttttatcgacgtgaagtctacaag
cgcctacttcagagagtgcttcacatctacaatcaaagtgaaactggatatcacacagtg
caggtcctgatgggctgtgaggagctgcctggattgagctacattcaaggacaatatgaa
atgatcttcaatggccatgatcaccttgcactaaatgaggacctgagcacttggactgca
gtgggcaaggcagctgagatcctgacccaagagtgggagaaggaaggttatgctcaacat
ttgaagtctttcctggagaggtattgtgtgaattcgctccactcacagctgtattatggg
aaggagtttttgctgagaacagacatcccgaaattacatgtgacccataaggtcagagct
gatgggaatgtgactctaaggtgctgggccctggaattttaccatactgagatcaccctg
acctggcagagggatggcaacaaccagactctggacatggaggtgatagagaccaggcca
gcaggagatggaaccttccagaagtgggcagctgtggtggtgcttcctggggaggagcag
agatacacatgccatgtgaaccatgaggggctgcctgagcccctcaccctgagatgggag
cctcctcagccctctgttcccatcatgttaattcttactggcctggttcttggagctgtg
cttatgggagctgtggtgacttttctgatatggattaagagaactaaaggtaagaaaagg
gcagggtctgagttcgtgtctctatgggaatatgaagcccagctgagagtgtgccctgcc
acatga

DBGET integrated database retrieval system