Cricetulus griseus (Chinese hamster): 100689032 Help Entry 100689032         CDS       T02813                                  Gene name Bax Definition (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge01521   EGFR tyrosine kinase inhibitor resistance cge01522   Endocrine resistance cge01524   Platinum drug resistance cge04071   Sphingolipid signaling pathway cge04115   p53 signaling pathway cge04141   Protein processing in endoplasmic reticulum cge04210   Apoptosis cge04211   Longevity regulating pathway cge04215   Apoptosis - multiple species cge04217   Necroptosis cge04722   Neurotrophin signaling pathway cge04932   Non-alcoholic fatty liver disease cge04933   AGE-RAGE signaling pathway in diabetic complications cge05012   Parkinson disease cge05014   Amyotrophic lateral sclerosis cge05016   Huntington disease cge05020   Prion disease cge05022   Pathways of neurodegeneration - multiple diseases cge05132   Salmonella infection cge05152   Tuberculosis cge05160   Hepatitis C cge05161   Hepatitis B cge05162   Measles cge05163   Human cytomegalovirus infection cge05164   Influenza A cge05165   Human papillomavirus infection cge05166   Human T-cell leukemia virus 1 infection cge05167   Kaposi sarcoma-associated herpesvirus infection cge05168   Herpes simplex virus 1 infection cge05169   Epstein-Barr virus infection cge05170   Human immunodeficiency virus 1 infection cge05200   Pathways in cancer cge05202   Transcriptional misregulation in cancer cge05203   Viral carcinogenesis cge05210   Colorectal cancer cge05212   Pancreatic cancer cge05213   Endometrial cancer cge05214   Glioma cge05216   Thyroid cancer cge05217   Basal cell carcinoma cge05218   Melanoma cge05220   Chronic myeloid leukemia cge05222   Small cell lung cancer cge05223   Non-small cell lung cancer cge05224   Breast cancer cge05225   Hepatocellular carcinoma cge05226   Gastric cancer Brite KEGG Orthology (KO) [BR:cge00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100689032 (Bax)  09130 Environmental Information Processing   09132 Signal transduction    04071 Sphingolipid signaling pathway     100689032 (Bax)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100689032 (Bax)    04215 Apoptosis - multiple species     100689032 (Bax)    04217 Necroptosis     100689032 (Bax)    04115 p53 signaling pathway     100689032 (Bax)  09150 Organismal Systems   09156 Nervous system    04722 Neurotrophin signaling pathway     100689032 (Bax)   09149 Aging    04211 Longevity regulating pathway     100689032 (Bax)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100689032 (Bax)    05202 Transcriptional misregulation in cancer     100689032 (Bax)    05203 Viral carcinogenesis     100689032 (Bax)   09162 Cancer: specific types    05210 Colorectal cancer     100689032 (Bax)    05212 Pancreatic cancer     100689032 (Bax)    05225 Hepatocellular carcinoma     100689032 (Bax)    05226 Gastric cancer     100689032 (Bax)    05214 Glioma     100689032 (Bax)    05216 Thyroid cancer     100689032 (Bax)    05220 Chronic myeloid leukemia     100689032 (Bax)    05217 Basal cell carcinoma     100689032 (Bax)    05218 Melanoma     100689032 (Bax)    05213 Endometrial cancer     100689032 (Bax)    05224 Breast cancer     100689032 (Bax)    05222 Small cell lung cancer     100689032 (Bax)    05223 Non-small cell lung cancer     100689032 (Bax)   09164 Neurodegenerative disease    05012 Parkinson disease     100689032 (Bax)    05014 Amyotrophic lateral sclerosis     100689032 (Bax)    05016 Huntington disease     100689032 (Bax)    05020 Prion disease     100689032 (Bax)    05022 Pathways of neurodegeneration - multiple diseases     100689032 (Bax)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100689032 (Bax)    04933 AGE-RAGE signaling pathway in diabetic complications     100689032 (Bax)   09171 Infectious disease: bacterial    05132 Salmonella infection     100689032 (Bax)    05152 Tuberculosis     100689032 (Bax)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100689032 (Bax)    05170 Human immunodeficiency virus 1 infection     100689032 (Bax)    05161 Hepatitis B     100689032 (Bax)    05160 Hepatitis C     100689032 (Bax)    05164 Influenza A     100689032 (Bax)    05162 Measles     100689032 (Bax)    05168 Herpes simplex virus 1 infection     100689032 (Bax)    05163 Human cytomegalovirus infection     100689032 (Bax)    05167 Kaposi sarcoma-associated herpesvirus infection     100689032 (Bax)    05169 Epstein-Barr virus infection     100689032 (Bax)    05165 Human papillomavirus infection     100689032 (Bax)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100689032 (Bax)    01524 Platinum drug resistance     100689032 (Bax)    01522 Endocrine resistance     100689032 (Bax)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cge03029]     100689032 (Bax)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cge02000]     100689032 (Bax) Mitochondrial biogenesis [BR:cge03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     100689032 (Bax) Transporters [BR:cge02000]  Other transporters   Pores ion channels [TC:1]    100689032 (Bax) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Bclx_interact CF222 Motif Other DBs NCBI-GeneID:  100689032 NCBI-ProteinID:  NP_001230949 UniProt:  A1E3K3 LinkDB All DBs AA seq 192 aa AA seqDB search MDGSGEQLGGGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGDTPELTLEQPPQDPSTKKLS ECLRRIGDELDSNMELQRMIANVDTNSPREVFFRVAADMFADGNFNWGRVVALFYFASKL VLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV LTASLTIWKNMG NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggacgggtcgggggagcagctcggaggcggcgggcccaccagctctgagcagatcatg aagacaggggcctttttgctacagggtttcatccaggatcgagctgggaggatggccggg gatacacctgagctgaccttggagcagccaccccaggatccgtctaccaagaagttgagc gagtgcctcaggcgaattggagatgagctggacagcaacatggagctgcagaggatgatt gctaatgtggatactaactccccacgagaggtcttcttccgtgtggcagctgacatgttt gctgatggcaacttcaactggggccgggttgttgcccttttctactttgctagcaaactg gtgctcaaggccctgtgtaccaaagtgcccgagctaatcagaaccatcatgggctggaca ctggacttcctccgagagcggctgcttgtctggatccaagaccagggtggctgggatggc ctcctctcatacttcgggacccccacctggcagacagtgactatctttgtggctggagtc ctcactgcctcactcacgatctggaagaacatgggctga

DBGET integrated database retrieval system