KEGG   Cricetulus griseus (Chinese hamster): 100689032
Entry
100689032         CDS       T02813                                 

Gene name
Bax
Definition
(RefSeq) apoptosis regulator BAX
  KO
K02159  apoptosis regulator BAX
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge01524  Platinum drug resistance
cge04071  Sphingolipid signaling pathway
cge04115  p53 signaling pathway
cge04141  Protein processing in endoplasmic reticulum
cge04210  Apoptosis
cge04211  Longevity regulating pathway
cge04215  Apoptosis - multiple species
cge04217  Necroptosis
cge04722  Neurotrophin signaling pathway
cge04932  Non-alcoholic fatty liver disease
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge05012  Parkinson disease
cge05014  Amyotrophic lateral sclerosis
cge05016  Huntington disease
cge05020  Prion disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05132  Salmonella infection
cge05152  Tuberculosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05216  Thyroid cancer
cge05217  Basal cell carcinoma
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100689032 (Bax)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100689032 (Bax)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100689032 (Bax)
   04215 Apoptosis - multiple species
    100689032 (Bax)
   04217 Necroptosis
    100689032 (Bax)
   04115 p53 signaling pathway
    100689032 (Bax)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100689032 (Bax)
  09149 Aging
   04211 Longevity regulating pathway
    100689032 (Bax)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100689032 (Bax)
   05202 Transcriptional misregulation in cancer
    100689032 (Bax)
   05203 Viral carcinogenesis
    100689032 (Bax)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100689032 (Bax)
   05212 Pancreatic cancer
    100689032 (Bax)
   05225 Hepatocellular carcinoma
    100689032 (Bax)
   05226 Gastric cancer
    100689032 (Bax)
   05214 Glioma
    100689032 (Bax)
   05216 Thyroid cancer
    100689032 (Bax)
   05220 Chronic myeloid leukemia
    100689032 (Bax)
   05217 Basal cell carcinoma
    100689032 (Bax)
   05218 Melanoma
    100689032 (Bax)
   05213 Endometrial cancer
    100689032 (Bax)
   05224 Breast cancer
    100689032 (Bax)
   05222 Small cell lung cancer
    100689032 (Bax)
   05223 Non-small cell lung cancer
    100689032 (Bax)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100689032 (Bax)
   05014 Amyotrophic lateral sclerosis
    100689032 (Bax)
   05016 Huntington disease
    100689032 (Bax)
   05020 Prion disease
    100689032 (Bax)
   05022 Pathways of neurodegeneration - multiple diseases
    100689032 (Bax)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100689032 (Bax)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100689032 (Bax)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100689032 (Bax)
   05152 Tuberculosis
    100689032 (Bax)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100689032 (Bax)
   05170 Human immunodeficiency virus 1 infection
    100689032 (Bax)
   05161 Hepatitis B
    100689032 (Bax)
   05160 Hepatitis C
    100689032 (Bax)
   05164 Influenza A
    100689032 (Bax)
   05162 Measles
    100689032 (Bax)
   05168 Herpes simplex virus 1 infection
    100689032 (Bax)
   05163 Human cytomegalovirus infection
    100689032 (Bax)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100689032 (Bax)
   05169 Epstein-Barr virus infection
    100689032 (Bax)
   05165 Human papillomavirus infection
    100689032 (Bax)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100689032 (Bax)
   01524 Platinum drug resistance
    100689032 (Bax)
   01522 Endocrine resistance
    100689032 (Bax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cge03029]
    100689032 (Bax)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cge02000]
    100689032 (Bax)
Mitochondrial biogenesis [BR:cge03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100689032 (Bax)
Transporters [BR:cge02000]
 Other transporters
  Pores ion channels [TC:1]
   100689032 (Bax)
SSDB
Motif
Pfam: Bcl-2 Bclx_interact CF222
Other DBs
NCBI-GeneID: 100689032
NCBI-ProteinID: NP_001230949
UniProt: A1E3K3
LinkDB
AA seq 192 aa
MDGSGEQLGGGGPTSSEQIMKTGAFLLQGFIQDRAGRMAGDTPELTLEQPPQDPSTKKLS
ECLRRIGDELDSNMELQRMIANVDTNSPREVFFRVAADMFADGNFNWGRVVALFYFASKL
VLKALCTKVPELIRTIMGWTLDFLRERLLVWIQDQGGWDGLLSYFGTPTWQTVTIFVAGV
LTASLTIWKNMG
NT seq 579 nt   +upstreamnt  +downstreamnt
atggacgggtcgggggagcagctcggaggcggcgggcccaccagctctgagcagatcatg
aagacaggggcctttttgctacagggtttcatccaggatcgagctgggaggatggccggg
gatacacctgagctgaccttggagcagccaccccaggatccgtctaccaagaagttgagc
gagtgcctcaggcgaattggagatgagctggacagcaacatggagctgcagaggatgatt
gctaatgtggatactaactccccacgagaggtcttcttccgtgtggcagctgacatgttt
gctgatggcaacttcaactggggccgggttgttgcccttttctactttgctagcaaactg
gtgctcaaggccctgtgtaccaaagtgcccgagctaatcagaaccatcatgggctggaca
ctggacttcctccgagagcggctgcttgtctggatccaagaccagggtggctgggatggc
ctcctctcatacttcgggacccccacctggcagacagtgactatctttgtggctggagtc
ctcactgcctcactcacgatctggaagaacatgggctga

DBGET integrated database retrieval system