KEGG   Cricetulus griseus (Chinese hamster): 100689063
Entry
100689063         CDS       T02813                                 

Gene name
Ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04115  p53 signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04152  AMPK signaling pathway
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04340  Hedgehog signaling pathway
cge04371  Apelin signaling pathway
cge04390  Hippo signaling pathway
cge04510  Focal adhesion
cge04530  Tight junction
cge04630  JAK-STAT signaling pathway
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04934  Cushing syndrome
cge05160  Hepatitis C
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100689063 (Ccnd1)
   04340 Hedgehog signaling pathway
    100689063 (Ccnd1)
   04390 Hippo signaling pathway
    100689063 (Ccnd1)
   04371 Apelin signaling pathway
    100689063 (Ccnd1)
   04630 JAK-STAT signaling pathway
    100689063 (Ccnd1)
   04068 FoxO signaling pathway
    100689063 (Ccnd1)
   04151 PI3K-Akt signaling pathway
    100689063 (Ccnd1)
   04152 AMPK signaling pathway
    100689063 (Ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100689063 (Ccnd1)
   04115 p53 signaling pathway
    100689063 (Ccnd1)
   04218 Cellular senescence
    100689063 (Ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100689063 (Ccnd1)
   04530 Tight junction
    100689063 (Ccnd1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100689063 (Ccnd1)
   04921 Oxytocin signaling pathway
    100689063 (Ccnd1)
   04919 Thyroid hormone signaling pathway
    100689063 (Ccnd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100689063 (Ccnd1)
   05206 MicroRNAs in cancer
    100689063 (Ccnd1)
   05205 Proteoglycans in cancer
    100689063 (Ccnd1)
   05203 Viral carcinogenesis
    100689063 (Ccnd1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100689063 (Ccnd1)
   05212 Pancreatic cancer
    100689063 (Ccnd1)
   05225 Hepatocellular carcinoma
    100689063 (Ccnd1)
   05226 Gastric cancer
    100689063 (Ccnd1)
   05214 Glioma
    100689063 (Ccnd1)
   05216 Thyroid cancer
    100689063 (Ccnd1)
   05221 Acute myeloid leukemia
    100689063 (Ccnd1)
   05220 Chronic myeloid leukemia
    100689063 (Ccnd1)
   05218 Melanoma
    100689063 (Ccnd1)
   05219 Bladder cancer
    100689063 (Ccnd1)
   05215 Prostate cancer
    100689063 (Ccnd1)
   05213 Endometrial cancer
    100689063 (Ccnd1)
   05224 Breast cancer
    100689063 (Ccnd1)
   05222 Small cell lung cancer
    100689063 (Ccnd1)
   05223 Non-small cell lung cancer
    100689063 (Ccnd1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100689063 (Ccnd1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100689063 (Ccnd1)
   04934 Cushing syndrome
    100689063 (Ccnd1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100689063 (Ccnd1)
   05162 Measles
    100689063 (Ccnd1)
   05160 Hepatitis C
    100689063 (Ccnd1)
   05163 Human cytomegalovirus infection
    100689063 (Ccnd1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100689063 (Ccnd1)
   05169 Epstein-Barr virus infection
    100689063 (Ccnd1)
   05165 Human papillomavirus infection
    100689063 (Ccnd1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100689063 (Ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100689063
NCBI-ProteinID: NP_001230977
UniProt: A5A422
LinkDB
AA seq 295 aa
MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQREIVPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNYLSCYRTTHFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNINPKATEEEGEAEGETDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggagaccatccgccgcgcgtaccctgacacc
aacctcctgaacgaccgagtgctgcgagccatgctcaagaccgaggagacctgcgcgccc
tccgtgtcttacttcaagtgcgtgcagagggagattgtgccgtccatgcggaaaatcgtg
gccacctggatgctggaggtctgcgaggagcagaagtgcgaagaggaggtcttccctctg
gccatgaactacctggaccgtttcctgtctctggagcccctaaaaaagagccgcctgcag
ctgctaggggccacctgcatgttcgtggcctccaagatgaaggagaccattcctttgacc
gccgagaagttgtgcatctacactgacaactctatccggcccgaggagctgctgcaaatg
gaactccttctggtgaacaaacttaagtggaacctggccgccatgactccccacgatttc
atcgaacacttcctctccaaaatgccagaggcggatgagaacaagcagatcatccgcaag
catgcgcagacctttgtggccctctgtgccacagacgtgaagttcatttccaacccgccc
tccatggtggctgccgggagcgtggtggctgcaatgcaaggcctgaacctgggcagcccc
aacaactacctgtcctgctaccgcacaacgcactttctttccagagtaatcaagtgtgac
ccggactgcctccgcgcctgccaggaacagattgaggcccttctggagtccagcctgcgc
caggcccagcagaacatcaaccccaaggccaccgaggaagagggagaagcagagggagag
actgacctggcctgcacacccaccgatgtacgagatgtggacatctga

DBGET integrated database retrieval system