KEGG   Cricetulus griseus (Chinese hamster): 100689318Help
Entry
100689318         CDS       T02813                                 

Gene name
Akr1b8
Definition
(RefSeq) aldose reductase-related protein 2
  KO
K00011  aldehyde reductase [EC:1.1.1.21]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00040  Pentose and glucuronate interconversions
cge00051  Fructose and mannose metabolism
cge00052  Galactose metabolism
cge00561  Glycerolipid metabolism
cge00790  Folate biosynthesis
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100689318 (Akr1b8)
   00051 Fructose and mannose metabolism
    100689318 (Akr1b8)
   00052 Galactose metabolism
    100689318 (Akr1b8)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100689318 (Akr1b8)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100689318 (Akr1b8)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldehyde reductase
     100689318 (Akr1b8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 100689318
NCBI-ProteinID: NP_001233680
UniProt: O08782 G3IE21
LinkDB All DBs
Structure
PDB: 

AA seq 316 aa AA seqDB search
MSTFVELSTKAKMPIVGLGTWQSPPGQVKEAVKVAIDAGYRHIDCAYAYYNEHEVGEAIQ
EKIKEKAVRREDLFIVSKLWPTCFERKLLKEAFQKTLTDLKLDYLDLYLIHWPQGLQPGK
ELFPKDDQGNVLTSKITFLDAWEVMEELVDEGLVKALGVSNFNHFQIERILNKPGLKHKP
VTNQVECHPYLTQEKLIEYCHSKGITVTAYSPLGSPNRPWAKPEDPSLLEDPKIKEIAAK
HKKTSAQVLIRFHIQRNVVVIPKSVTPARIHENFQVFDFQLSDQEMATILGFNRNWRACL
LPETVNMEEYPYDAEY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtccactttcgtggagctcagtaccaaagccaagatgcccatcgtgggcctgggcacc
tggcagtctcccccaggccaagtcaaggaagctgtgaaggtggccattgatgctggatac
cgccacattgactgcgcctatgcgtattacaatgagcacgaagtgggagaggccattcaa
gagaagatcaaagagaaggctgtgagacgggaagacctcttcatcgtcagcaagttgtgg
cccacctgctttgagaggaaactgctaaaggaggcctttcagaagaccctcacggacctg
aaactggactatctggacctgtatcttattcactggccacagggacttcagcccggaaag
gagttatttcccaaagacgatcaaggcaacgtcctcaccagcaaaataacgttcttggat
gcctgggaggtcatggaagaactggtggatgaagggttagtgaaagccctgggtgtctcc
aacttcaaccacttccagattgaaaggatcctgaacaaacctggattgaaacataagcca
gtgaccaaccaggtcgagtgtcacccatacctcactcaggaaaaactgatcgagtactgt
cactccaagggcatcactgtcacagcctacagccctctgggttccccaaataggccttgg
gccaagccagaagacccttcactcctagaggaccccaagattaaagagattgctgcaaag
cacaagaaaacctcggcccaggttctgattcgattccacatccagaggaatgtggtggtg
atccccaagtctgtgacaccagcacgtatacatgagaactttcaggtctttgacttccag
ttgagtgatcaggagatggccaccatccttggcttcaacagaaactggagggcctgcctg
ctgcctgagacagtaaacatggaagaatatccctacgatgcggagtattga

KEGG   Cricetulus griseus (Chinese hamster): 100751272Help
Entry
100751272         CDS       T02813                                 

Gene name
Akr1b1
Definition
(RefSeq) aldose reductase
  KO
K00011  aldehyde reductase [EC:1.1.1.21]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00040  Pentose and glucuronate interconversions
cge00051  Fructose and mannose metabolism
cge00052  Galactose metabolism
cge00561  Glycerolipid metabolism
cge00790  Folate biosynthesis
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100751272 (Akr1b1)
   00051 Fructose and mannose metabolism
    100751272 (Akr1b1)
   00052 Galactose metabolism
    100751272 (Akr1b1)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100751272 (Akr1b1)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100751272 (Akr1b1)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldehyde reductase
     100751272 (Akr1b1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 100751272
NCBI-ProteinID: XP_027247220
UniProt: G3HH30
LinkDB All DBs
Position
1
AA seq 316 aa AA seqDB search
MVSHLQLNNGAKMPILGLGTWKSPPGQVTEAVKAAIDIGYRHIDCAQVYQNEKEVGMALQ
EKLKEQVVKRQDLFIVSKLWCTFHDKSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDESGNVIPSETDFVDTWTAMEQLVDEGLVKSIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIASK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENLKVFDFELSKEDVTTLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggtcagccacctgcagctcaacaacggcgccaagatgcccatcctgggcctgggcacc
tggaagtcccctcccggccaggtgactgaggccgtgaaggctgccattgacattgggtac
cgccacattgactgtgcccaggtgtaccagaatgagaaggaggtgggaatggccctccag
gagaagctcaaggagcaggtggtgaaacgccaagacctcttcatcgtcagcaagctgtgg
tgcacgtttcacgacaagagcatggtgaaaggagcttgccagaagacgctcagtgacctg
cagctggactacctggacctctaccttattcactggccaacaggtttcaagcccgggcct
gattacttcccactggacgaatcaggaaatgtgattcccagtgagactgattttgtggac
acttggacggccatggaacagctggtggatgaaggtttggtgaaatccattggtgtctcc
aacttcaaccctcttcagattgagagaatcttaaacaaacccggcttaaaatataagcct
gcggttaatcagattgaatgccacccgtacctaactcaggagaagctgattgagtactgc
caatccaaaggcatcgtggtgaccgcgtacagtccccttggctctcctgacaggccctgg
gccaagcctgaagacccttctctcttggaggatcccaggattaaggcaattgcatccaag
tacaataaaacaacagctcaggtgctgatccggttccccatacaaaggaacttggtggtg
atccccaagtccgtgacaccagcaagaattgctgagaacctgaaggtctttgacttcgag
ctgagcaaggaggatgtgaccactctactcagctacaacaggaactggagggtgtgtgcc
ttgatgagctgtgctaaacacaaggattaccccttccacgcagaagtctga

KEGG   Cricetulus griseus (Chinese hamster): 100757262Help
Entry
100757262         CDS       T02813                                 

Definition
(RefSeq) aldose reductase-related protein 1 isoform X1
  KO
K00011  aldehyde reductase [EC:1.1.1.21]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00040  Pentose and glucuronate interconversions
cge00051  Fructose and mannose metabolism
cge00052  Galactose metabolism
cge00561  Glycerolipid metabolism
cge00790  Folate biosynthesis
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100757262
   00051 Fructose and mannose metabolism
    100757262
   00052 Galactose metabolism
    100757262
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100757262
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100757262
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldehyde reductase
     100757262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 100757262
NCBI-ProteinID: XP_027247221
LinkDB All DBs
Position
1
AA seq 277 aa AA seqDB search
MATFVELSTKAKMPIVGLGTWKSPPGKVKEAVKAAIDAGYRHIDCAYAYRNESEVGEAIQ
EKIKEKAVRREDLFIVSKAGSEMVPTDSEGKVLMSKSTFLDAWEGMEELVDQGLVKALGI
SNFNHLQIERLLNKPGLKHKPVTNQIECHPYLTQEKLIQYCHSKGIGITAYSPLGSPDRP
HAKPEDPVVLEIPKIKDIAAKHKKTVAQVLIRFHIQRNVVVIPKSVTPSRIRENFQVFDF
QLSDEEMATILSFNKNWRACGLLAAINEPDYPFHEEY
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggccaccttcgtggagctcagtaccaaagccaagatgcccattgtgggcctgggcacc
tggaagtctccgccaggcaaagtcaaggaagctgtgaaggccgccattgatgccggatac
cgccacatagactgtgcctatgcctatcggaatgagagtgaagtgggagaggccatccaa
gagaagatcaaagagaaggccgtgagacgggaagacctcttcatcgtcagcaaggctggg
agtgagatggtccccacagatagtgaaggcaaagttctcatgagtaaatccaccttcttg
gatgcctgggagggcatggaggaactggtggaccagggactggtgaaagccctgggcatc
tccaacttcaaccacttgcagattgaaaggctcctgaacaagcctggactcaaacataag
ccagtgaccaaccagattgagtgccacccatacctcacccaggagaaactgatccagtac
tgtcactccaagggcattggcatcacggcctacagccccctgggctctccagacagacct
catgccaagccagaagaccctgtagtactggagattcccaaaatcaaagatatcgctgca
aagcacaagaaaacagtagctcaggttctgattcggttccatatccagaggaatgtggtg
gtgatccccaagtctgtgacaccctcccggatacgagagaactttcaggtctttgacttc
cagttgagtgatgaggagatggccaccattctcagcttcaacaaaaactggagggcctgt
ggcttattggctgccattaatgaaccggactatcctttccatgaggaatactga

KEGG   Cricetulus griseus (Chinese hamster): 100758120Help
Entry
100758120         CDS       T02813                                 

Definition
(RefSeq) aldose reductase-related protein 2
  KO
K00011  aldehyde reductase [EC:1.1.1.21]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00040  Pentose and glucuronate interconversions
cge00051  Fructose and mannose metabolism
cge00052  Galactose metabolism
cge00561  Glycerolipid metabolism
cge00790  Folate biosynthesis
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100758120
   00051 Fructose and mannose metabolism
    100758120
   00052 Galactose metabolism
    100758120
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100758120
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100758120
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.21  aldehyde reductase
     100758120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 100758120
NCBI-ProteinID: XP_027247223
LinkDB All DBs
Position
1
AA seq 316 aa AA seqDB search
MATFVGLSNKAKMPIVGLGTWKSPPSKVKEAVKAAIDAGYRHIDCAYLYENESGVGEGIR
EKLQEKAVNREDLFIVSKLWPTFFEKSLVKKAFQKTLTDLKLDYLDLYLVHWPQGFQPGK
EFFPTDDKGNILTSKHTFLDAWEVMEELVDQGLVKALGISNFNHLQIERLLNKPGLKHKP
VTNQIECHPYLTQEKLIEYCHSKGITVTAYCPLGSPARPWAKPEDPSLLEDPQIKEIAAK
HKKTPAQVLIRFHIQRNVAVIPKSVTPERIHENFQVFDFKLSNEEMATLLSFNRNWRVCS
LPVTINAEDYPFHVNF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggccacctttgtgggactcagtaacaaagccaagatgcccatcgtgggcctgggcacc
tggaagtctcccccaagcaaagtcaaggaagctgtgaaggccgccatcgatgctggatac
cgccacattgactgtgcctatctgtacgagaacgagagtggagtgggagaagggattaga
gagaagctccaggagaaggccgtgaatcgggaagacctcttcattgtcagcaagctgtgg
cccaccttctttgagaaaagcctggtgaagaaagcctttcagaaaaccctcaccgatctg
aaactggactatctggacctgtatctagttcactggccacagggatttcagcctgggaag
gagtttttccccactgatgataaaggcaacattctcaccagtaaacacacattcctggat
gcttgggaggtcatggaggaactggtggaccagggactagtgaaagccctgggcatctcc
aacttcaaccacttacagattgaaaggcttctgaacaagcctggactcaaacataagcca
gtgaccaaccagatcgaatgtcacccatacctcactcaggaaaaactgattgagtactgt
cattccaagggtatcactgtcacagcctactgtcctctgggctctccagctaggccttgg
gccaagccagaggacccttcactcctagaggacccccaaattaaggagatagctgcaaag
cacaagaaaaccccagcccaggttctgattcgcttccacatccagaggaatgtggctgtc
atccccaagtctgtgacaccagaacgtatacatgagaactttcaggtctttgacttcaag
ttgagtaatgaagagatggccacccttctcagcttcaacagaaactggagggtctgttcc
ttgcctgtaacaattaatgcggaggactaccctttccatgtgaacttctga

DBGET integrated database retrieval system