KEGG   Cricetulus griseus (Chinese hamster): 100689325Help
Entry
100689325         CDS       T02813                                 

Gene name
Ugp2
Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00040  Pentose and glucuronate interconversions
cge00052  Galactose metabolism
cge00500  Starch and sucrose metabolism
cge00520  Amino sugar and nucleotide sugar metabolism
cge01100  Metabolic pathways
Module
cge_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
cge_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
cge_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100689325 (Ugp2)
   00052 Galactose metabolism
    100689325 (Ugp2)
   00500 Starch and sucrose metabolism
    100689325 (Ugp2)
   00520 Amino sugar and nucleotide sugar metabolism
    100689325 (Ugp2)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100689325 (Ugp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 100689325
NCBI-ProteinID: NP_001233687
UniProt: O35156 G3HDQ1
LinkDB All DBs
AA seq 508 aa AA seqDB search
MSRFVQDLSKAMSQDGASQFQEVILQELELSVKKELEKILTTATSHEYEHTKKDLDGFRK
LYHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVQQIEHLNKSYNTDVPLVLMNSFNTDEDTKKILQKYNH
CRVKIYTFNQSRYPRINKESLLPVAKDVSSSGESTEAWYPPGHGDIYASFYNSGLLDTFL
EEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEG
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNPKTLD
GGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSE
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagatttgtgcaagaccttagcaaagctatgtctcaagatggtgcttctcagttc
caagaagtcattctccaagaactagaattatctgtgaagaaagaattagaaaaaatactt
acaacagcaacctcacatgagtatgagcatactaaaaaagatcttgatggatttcggaag
ctatatcatagatttttgcaagaaaagggaccttctgtagactggggtaaaatccagaga
cctccagaagattcgattcaaccctatgaaaagataaaggccagaggcctgcctgataat
atatcttctgtgttgaacaaactggtggtggtgaaactcaatggtggtttgggaaccagt
atgggctgcaaaggccctaaaagtctgattggtgtaagaaatgagaatacctttttggat
ctaactgtgcagcaaattgaacatttgaacaaaagctacaatacagatgtccctcttgtt
ttaatgaactcttttaacacggatgaagacacaaaaaaaatacttcagaagtacaatcat
tgccgtgtgaaaatctacaccttcaatcaaagcaggtatccgaggattaataaggaatct
ttacttcctgtagcaaaggatgtgtcttcctcaggggaaagtacagaagcttggtacccc
ccaggacatggagatatctatgctagtttctacaactcgggcttgctcgacacctttcta
gaagaaggcaaagagtatatttttgtttctaacatagataacctgggtgccacagtggat
ctttatattcttaatcatctaatgaacccacccaatgggaaacgctgtgaatttgtcatg
gaagtcacaaataaaacacgagcagatgtaaagggtggaacactcactcaatatgaaggc
aaactgagactggtggagattgctcaagtgccaaaagcacatgttgatgaattcaagtct
gtgtcaaaatttaaaatatttaacacaaacaacctatggatctctcttgcagcagttaaa
agactgcaggagcagaatgccattgacatggaaatcattgtgaatccaaagactttggat
ggaggcctgaatgttattcagttagaaactgcagttggagctgcaattaaaagtttcgag
aattctttaggtattaatgttccaaggagtcgttttctgcctgtgaagaccacgtcagat
ctcttgcttgtgatgtcaaacctctatagccttaatgcaggatctttgaccatgagtgaa
aagcgggagtttcctacagtacccttggttaaattaggaagttcctttaccaaggttcaa
gattacctaaggaggtttgaaagtatacctgacatgctggaattggatcacctcactgtt
tctggagatgtgacatttggaaaaaatgtttcattaaagggaacagttatcattattgca
aatcatggtgacagaattgacatcccccctggagcagtgttagagaacaagatcgtatct
ggaaatcttcgaatcttggatcactaa

DBGET integrated database retrieval system