KEGG   Cricetulus griseus (Chinese hamster): 100689368
Entry
100689368         CDS       T02813                                 

Gene name
Bak1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01524  Platinum drug resistance
cge04141  Protein processing in endoplasmic reticulum
cge04210  Apoptosis
cge04215  Apoptosis - multiple species
cge05022  Pathways of neurodegeneration - multiple diseases
cge05132  Salmonella infection
cge05160  Hepatitis C
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05216  Thyroid cancer
cge05217  Basal cell carcinoma
cge05218  Melanoma
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100689368 (Bak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100689368 (Bak1)
   04215 Apoptosis - multiple species
    100689368 (Bak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100689368 (Bak1)
   05202 Transcriptional misregulation in cancer
    100689368 (Bak1)
   05206 MicroRNAs in cancer
    100689368 (Bak1)
   05203 Viral carcinogenesis
    100689368 (Bak1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100689368 (Bak1)
   05212 Pancreatic cancer
    100689368 (Bak1)
   05225 Hepatocellular carcinoma
    100689368 (Bak1)
   05226 Gastric cancer
    100689368 (Bak1)
   05214 Glioma
    100689368 (Bak1)
   05216 Thyroid cancer
    100689368 (Bak1)
   05220 Chronic myeloid leukemia
    100689368 (Bak1)
   05217 Basal cell carcinoma
    100689368 (Bak1)
   05218 Melanoma
    100689368 (Bak1)
   05213 Endometrial cancer
    100689368 (Bak1)
   05224 Breast cancer
    100689368 (Bak1)
   05222 Small cell lung cancer
    100689368 (Bak1)
   05223 Non-small cell lung cancer
    100689368 (Bak1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    100689368 (Bak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100689368 (Bak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100689368 (Bak1)
   05160 Hepatitis C
    100689368 (Bak1)
   05164 Influenza A
    100689368 (Bak1)
   05162 Measles
    100689368 (Bak1)
   05168 Herpes simplex virus 1 infection
    100689368 (Bak1)
   05163 Human cytomegalovirus infection
    100689368 (Bak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100689368 (Bak1)
   05169 Epstein-Barr virus infection
    100689368 (Bak1)
   05165 Human papillomavirus infection
    100689368 (Bak1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100689368 (Bak1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cge03029]
    100689368 (Bak1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cge02000]
    100689368 (Bak1)
Mitochondrial biogenesis [BR:cge03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    100689368 (Bak1)
Transporters [BR:cge02000]
 Other transporters
  Pores ion channels [TC:1]
   100689368 (Bak1)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 100689368
NCBI-ProteinID: NP_001233724
UniProt: A1E3K4
LinkDB
AA seq 209 aa
MASGQGPGPPRQDCDDSPSPSEQQVAQDTEEVFRSYVFHLHHQEQETQGAAAPANPEMDN
LLLEPNSILGQVGRQLAIIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSG
ISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHCIARWIAQRGGWVAALN
LRRDPILIVMTILGVVLLGQYVVHRFFRS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcgtctggacaaggaccaggtcctcctaggcaggactgtgatgactccccctcccct
tctgaacagcaggtggcccaggacacagaggaggtctttcgaagctatgttttccatctc
caccatcaggaacaagagacccagggggcggctgcccctgccaaccccgagatggacaat
ttgctcctagaacccaacagcatcttgggtcaggtgggccggcagcttgctatcattgga
gatgacattaaccggagatacgacacagagttccagaatttactggagcagctgcagccc
acagctgggaatgcctacgaactcttcaccaagattgcctccagcctatttaagagcggc
atcagctggggccgtgtggtggctctcctgggcttcggctaccgcctggccctgtatgtc
taccaacgtggtttgaccggcttcctgggccaggtgacctgctttttggcggatatcata
ctgcaccattgcatcgccaggtggattgcgcagagaggcggctgggtggcggccctgaat
ctgcgcagagacccaatcctgattgtgatgacaattcttggtgtggttctgttgggccag
tacgtggtacacagattcttcagatcatga

DBGET integrated database retrieval system