KEGG   Cricetulus griseus (Chinese hamster): 100689371
Entry
100689371         CDS       T02813                                 

Gene name
Bcl2l1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01524  Platinum drug resistance
cge04014  Ras signaling pathway
cge04064  NF-kappa B signaling pathway
cge04115  p53 signaling pathway
cge04137  Mitophagy - animal
cge04140  Autophagy - animal
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04215  Apoptosis - multiple species
cge04621  NOD-like receptor signaling pathway
cge04630  JAK-STAT signaling pathway
cge05012  Parkinson disease
cge05014  Amyotrophic lateral sclerosis
cge05022  Pathways of neurodegeneration - multiple diseases
cge05145  Toxoplasmosis
cge05162  Measles
cge05166  Human T-cell leukemia virus 1 infection
cge05168  Herpes simplex virus 1 infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05212  Pancreatic cancer
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100689371 (Bcl2l1)
   04630 JAK-STAT signaling pathway
    100689371 (Bcl2l1)
   04064 NF-kappa B signaling pathway
    100689371 (Bcl2l1)
   04151 PI3K-Akt signaling pathway
    100689371 (Bcl2l1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100689371 (Bcl2l1)
   04137 Mitophagy - animal
    100689371 (Bcl2l1)
  09143 Cell growth and death
   04210 Apoptosis
    100689371 (Bcl2l1)
   04215 Apoptosis - multiple species
    100689371 (Bcl2l1)
   04115 p53 signaling pathway
    100689371 (Bcl2l1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100689371 (Bcl2l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100689371 (Bcl2l1)
   05202 Transcriptional misregulation in cancer
    100689371 (Bcl2l1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100689371 (Bcl2l1)
   05225 Hepatocellular carcinoma
    100689371 (Bcl2l1)
   05220 Chronic myeloid leukemia
    100689371 (Bcl2l1)
   05222 Small cell lung cancer
    100689371 (Bcl2l1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100689371 (Bcl2l1)
   05014 Amyotrophic lateral sclerosis
    100689371 (Bcl2l1)
   05022 Pathways of neurodegeneration - multiple diseases
    100689371 (Bcl2l1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100689371 (Bcl2l1)
   05170 Human immunodeficiency virus 1 infection
    100689371 (Bcl2l1)
   05162 Measles
    100689371 (Bcl2l1)
   05168 Herpes simplex virus 1 infection
    100689371 (Bcl2l1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100689371 (Bcl2l1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100689371 (Bcl2l1)
   01524 Platinum drug resistance
    100689371 (Bcl2l1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100689371 (Bcl2l1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100689371 (Bcl2l1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cge02000]
    100689371 (Bcl2l1)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100689371 (Bcl2l1)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100689371 (Bcl2l1)
Transporters [BR:cge02000]
 Other transporters
  Pores ion channels [TC:1]
   100689371 (Bcl2l1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100689371
NCBI-ProteinID: NP_001233727
UniProt: B2Z3Z4 G3HEA7
LinkDB
AA seq 233 aa
MSQSNRELVVDFLSYKFSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP
WIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctagtggttgactttctctcctacaagttctcccagaaa
ggatacagctggagtcagtttagtgatgtcgaagagaacaggactgaggccccagaagga
actgaatcagagagggagacccccagtgccatcaatggcaacccatcctggcacctggcg
gacagccccgcggtaaatggagccactggccacagcagcagtttggatgcacgggaggtg
atccccatggcagccgtaaagcaagcgctgagagaggccggcgatgagtttgagctgcgg
taccggcgggcgttcagtgatctaacatcccagcttcatataaccccagggactgcatat
caaagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt
gtggcctttttctccttcggtggagccctctgtgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaagttggatggccacctacctgaatgaccacctagagcct
tggatccaggacaacggcggctgggacactttcgtggaactctacggaaacaatgcagca
gctgagagccggaaaggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg
gctggtgtggttctgctgggctctctcttcagtcggaagtga

DBGET integrated database retrieval system