Cricetulus griseus (Chinese hamster): 100689371 Help Entry 100689371         CDS       T02813                                  Gene name Bcl2l1 Definition (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge01521   EGFR tyrosine kinase inhibitor resistance cge01524   Platinum drug resistance cge04014   Ras signaling pathway cge04064   NF-kappa B signaling pathway cge04115   p53 signaling pathway cge04137   Mitophagy - animal cge04140   Autophagy - animal cge04151   PI3K-Akt signaling pathway cge04210   Apoptosis cge04215   Apoptosis - multiple species cge04621   NOD-like receptor signaling pathway cge04630   JAK-STAT signaling pathway cge05012   Parkinson disease cge05014   Amyotrophic lateral sclerosis cge05022   Pathways of neurodegeneration - multiple diseases cge05145   Toxoplasmosis cge05162   Measles cge05166   Human T-cell leukemia virus 1 infection cge05168   Herpes simplex virus 1 infection cge05170   Human immunodeficiency virus 1 infection cge05200   Pathways in cancer cge05202   Transcriptional misregulation in cancer cge05212   Pancreatic cancer cge05220   Chronic myeloid leukemia cge05222   Small cell lung cancer cge05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100689371 (Bcl2l1)    04630 JAK-STAT signaling pathway     100689371 (Bcl2l1)    04064 NF-kappa B signaling pathway     100689371 (Bcl2l1)    04151 PI3K-Akt signaling pathway     100689371 (Bcl2l1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100689371 (Bcl2l1)    04137 Mitophagy - animal     100689371 (Bcl2l1)   09143 Cell growth and death    04210 Apoptosis     100689371 (Bcl2l1)    04215 Apoptosis - multiple species     100689371 (Bcl2l1)    04115 p53 signaling pathway     100689371 (Bcl2l1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100689371 (Bcl2l1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100689371 (Bcl2l1)    05202 Transcriptional misregulation in cancer     100689371 (Bcl2l1)   09162 Cancer: specific types    05212 Pancreatic cancer     100689371 (Bcl2l1)    05225 Hepatocellular carcinoma     100689371 (Bcl2l1)    05220 Chronic myeloid leukemia     100689371 (Bcl2l1)    05222 Small cell lung cancer     100689371 (Bcl2l1)   09164 Neurodegenerative disease    05012 Parkinson disease     100689371 (Bcl2l1)    05014 Amyotrophic lateral sclerosis     100689371 (Bcl2l1)    05022 Pathways of neurodegeneration - multiple diseases     100689371 (Bcl2l1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100689371 (Bcl2l1)    05170 Human immunodeficiency virus 1 infection     100689371 (Bcl2l1)    05162 Measles     100689371 (Bcl2l1)    05168 Herpes simplex virus 1 infection     100689371 (Bcl2l1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100689371 (Bcl2l1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100689371 (Bcl2l1)    01524 Platinum drug resistance     100689371 (Bcl2l1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cge01009]     100689371 (Bcl2l1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cge03036]     100689371 (Bcl2l1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:cge02000]     100689371 (Bcl2l1) Protein phosphatases and associated proteins [BR:cge01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      100689371 (Bcl2l1) Chromosome and associated proteins [BR:cge03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Other centriole associated proteins     100689371 (Bcl2l1) Transporters [BR:cge02000]  Other transporters   Pores ion channels [TC:1]    100689371 (Bcl2l1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  100689371 NCBI-ProteinID:  NP_001233727 UniProt:  B2Z3Z4 G3HEA7 LinkDB All DBs AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKFSQKGYSWSQFSDVEENRTEAPEGTESERETPSAINGNPSWHLA DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP WIQDNGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctagtggttgactttctctcctacaagttctcccagaaa ggatacagctggagtcagtttagtgatgtcgaagagaacaggactgaggccccagaagga actgaatcagagagggagacccccagtgccatcaatggcaacccatcctggcacctggcg gacagccccgcggtaaatggagccactggccacagcagcagtttggatgcacgggaggtg atccccatggcagccgtaaagcaagcgctgagagaggccggcgatgagtttgagctgcgg taccggcgggcgttcagtgatctaacatcccagcttcatataaccccagggactgcatat caaagctttgaacaggtagtgaatgaactcttccgggatggggtaaactggggtcgcatt gtggcctttttctccttcggtggagccctctgtgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcaagttggatggccacctacctgaatgaccacctagagcct tggatccaggacaacggcggctgggacactttcgtggaactctacggaaacaatgcagca gctgagagccggaaaggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctctctcttcagtcggaagtga

DBGET integrated database retrieval system