KEGG   Cricetulus griseus (Chinese hamster): 100689401
Entry
100689401         CDS       T02813                                 

Gene name
Cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01522  Endocrine resistance
cge04012  ErbB signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04110  Cell cycle
cge04151  PI3K-Akt signaling pathway
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04934  Cushing syndrome
cge05162  Measles
cge05165  Human papillomavirus infection
cge05169  Epstein-Barr virus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05203  Viral carcinogenesis
cge05206  MicroRNAs in cancer
cge05215  Prostate cancer
cge05220  Chronic myeloid leukemia
cge05222  Small cell lung cancer
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100689401 (Cdkn1b)
   04066 HIF-1 signaling pathway
    100689401 (Cdkn1b)
   04068 FoxO signaling pathway
    100689401 (Cdkn1b)
   04151 PI3K-Akt signaling pathway
    100689401 (Cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100689401 (Cdkn1b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100689401 (Cdkn1b)
   05202 Transcriptional misregulation in cancer
    100689401 (Cdkn1b)
   05206 MicroRNAs in cancer
    100689401 (Cdkn1b)
   05203 Viral carcinogenesis
    100689401 (Cdkn1b)
  09162 Cancer: specific types
   05226 Gastric cancer
    100689401 (Cdkn1b)
   05220 Chronic myeloid leukemia
    100689401 (Cdkn1b)
   05215 Prostate cancer
    100689401 (Cdkn1b)
   05222 Small cell lung cancer
    100689401 (Cdkn1b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100689401 (Cdkn1b)
   04934 Cushing syndrome
    100689401 (Cdkn1b)
  09172 Infectious disease: viral
   05162 Measles
    100689401 (Cdkn1b)
   05169 Epstein-Barr virus infection
    100689401 (Cdkn1b)
   05165 Human papillomavirus infection
    100689401 (Cdkn1b)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100689401 (Cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100689401
NCBI-ProteinID: NP_001233754
UniProt: Q60439
LinkDB
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHNPLEGRYQWQEVDKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRQAVPSIG
SQAYSEDRHLVEQMPDPTDSPAGLAEQCPGMRKRPAADDSSSQNKRANRTEENVSDGSLN
AGSVEQTPKKPGLRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtacgagtatctaacgggagcccgagcctggagaggatggacgccagacaa
gcggagcaccccaagccctccgcctgcagaaacctcttcggcccggtcaatcacgaagag
ctcacccgggacttggagaagcactgccgagatatggaagaagcgagtcagcgcaagtgg
aatttcgactttcagaatcacaaccccctggaagggagataccagtggcaggaggtggac
aagggcagcttgccggagttctactacagacccccgcgcccccccaagggcgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgccaggcggtgccttcaattggc
tcccaggcatactctgaggaccggcatttggtggagcaaatgcctgatccgacggacagt
ccagcggggttagcggagcagtgcccagggatgaggaagcgacctgctgcagacgattct
tcttcgcaaaacaaaagggccaacagaacagaagaaaatgtttcagacggttccctgaac
gctggctctgtggagcagacgcccaagaagcccggcctccgaagacaccagacgtaa

DBGET integrated database retrieval system