KEGG   Cricetulus griseus (Chinese hamster): 100689403
Entry
100689403         CDS       T02813                                 

Gene name
Map2k1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04218  Cellular senescence
cge04270  Vascular smooth muscle contraction
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04613  Neutrophil extracellular trap formation
cge04620  Toll-like receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04928  Parathyroid hormone synthesis, secretion and action
cge04929  GnRH secretion
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05132  Salmonella infection
cge05135  Yersinia infection
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100689403 (Map2k1)
   04012 ErbB signaling pathway
    100689403 (Map2k1)
   04014 Ras signaling pathway
    100689403 (Map2k1)
   04015 Rap1 signaling pathway
    100689403 (Map2k1)
   04370 VEGF signaling pathway
    100689403 (Map2k1)
   04371 Apelin signaling pathway
    100689403 (Map2k1)
   04668 TNF signaling pathway
    100689403 (Map2k1)
   04066 HIF-1 signaling pathway
    100689403 (Map2k1)
   04068 FoxO signaling pathway
    100689403 (Map2k1)
   04072 Phospholipase D signaling pathway
    100689403 (Map2k1)
   04071 Sphingolipid signaling pathway
    100689403 (Map2k1)
   04024 cAMP signaling pathway
    100689403 (Map2k1)
   04022 cGMP-PKG signaling pathway
    100689403 (Map2k1)
   04151 PI3K-Akt signaling pathway
    100689403 (Map2k1)
   04150 mTOR signaling pathway
    100689403 (Map2k1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100689403 (Map2k1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100689403 (Map2k1)
   04210 Apoptosis
    100689403 (Map2k1)
   04218 Cellular senescence
    100689403 (Map2k1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100689403 (Map2k1)
   04540 Gap junction
    100689403 (Map2k1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100689403 (Map2k1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100689403 (Map2k1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100689403 (Map2k1)
   04620 Toll-like receptor signaling pathway
    100689403 (Map2k1)
   04650 Natural killer cell mediated cytotoxicity
    100689403 (Map2k1)
   04660 T cell receptor signaling pathway
    100689403 (Map2k1)
   04662 B cell receptor signaling pathway
    100689403 (Map2k1)
   04664 Fc epsilon RI signaling pathway
    100689403 (Map2k1)
   04666 Fc gamma R-mediated phagocytosis
    100689403 (Map2k1)
   04062 Chemokine signaling pathway
    100689403 (Map2k1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100689403 (Map2k1)
   04929 GnRH secretion
    100689403 (Map2k1)
   04912 GnRH signaling pathway
    100689403 (Map2k1)
   04915 Estrogen signaling pathway
    100689403 (Map2k1)
   04914 Progesterone-mediated oocyte maturation
    100689403 (Map2k1)
   04917 Prolactin signaling pathway
    100689403 (Map2k1)
   04921 Oxytocin signaling pathway
    100689403 (Map2k1)
   04926 Relaxin signaling pathway
    100689403 (Map2k1)
   04935 Growth hormone synthesis, secretion and action
    100689403 (Map2k1)
   04919 Thyroid hormone signaling pathway
    100689403 (Map2k1)
   04928 Parathyroid hormone synthesis, secretion and action
    100689403 (Map2k1)
   04916 Melanogenesis
    100689403 (Map2k1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100689403 (Map2k1)
  09156 Nervous system
   04725 Cholinergic synapse
    100689403 (Map2k1)
   04726 Serotonergic synapse
    100689403 (Map2k1)
   04720 Long-term potentiation
    100689403 (Map2k1)
   04730 Long-term depression
    100689403 (Map2k1)
   04722 Neurotrophin signaling pathway
    100689403 (Map2k1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100689403 (Map2k1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100689403 (Map2k1)
   05206 MicroRNAs in cancer
    100689403 (Map2k1)
   05205 Proteoglycans in cancer
    100689403 (Map2k1)
   05230 Central carbon metabolism in cancer
    100689403 (Map2k1)
   05231 Choline metabolism in cancer
    100689403 (Map2k1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100689403 (Map2k1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100689403 (Map2k1)
   05212 Pancreatic cancer
    100689403 (Map2k1)
   05225 Hepatocellular carcinoma
    100689403 (Map2k1)
   05226 Gastric cancer
    100689403 (Map2k1)
   05214 Glioma
    100689403 (Map2k1)
   05216 Thyroid cancer
    100689403 (Map2k1)
   05221 Acute myeloid leukemia
    100689403 (Map2k1)
   05220 Chronic myeloid leukemia
    100689403 (Map2k1)
   05218 Melanoma
    100689403 (Map2k1)
   05211 Renal cell carcinoma
    100689403 (Map2k1)
   05219 Bladder cancer
    100689403 (Map2k1)
   05215 Prostate cancer
    100689403 (Map2k1)
   05213 Endometrial cancer
    100689403 (Map2k1)
   05224 Breast cancer
    100689403 (Map2k1)
   05223 Non-small cell lung cancer
    100689403 (Map2k1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100689403 (Map2k1)
   05022 Pathways of neurodegeneration - multiple diseases
    100689403 (Map2k1)
  09165 Substance dependence
   05034 Alcoholism
    100689403 (Map2k1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100689403 (Map2k1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100689403 (Map2k1)
   05135 Yersinia infection
    100689403 (Map2k1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100689403 (Map2k1)
   05170 Human immunodeficiency virus 1 infection
    100689403 (Map2k1)
   05161 Hepatitis B
    100689403 (Map2k1)
   05160 Hepatitis C
    100689403 (Map2k1)
   05164 Influenza A
    100689403 (Map2k1)
   05163 Human cytomegalovirus infection
    100689403 (Map2k1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100689403 (Map2k1)
   05165 Human papillomavirus infection
    100689403 (Map2k1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100689403 (Map2k1)
   01522 Endocrine resistance
    100689403 (Map2k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100689403 (Map2k1)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100689403 (Map2k1)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: STE group
  STE7 family
   100689403 (Map2k1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6 Kdo
Other DBs
NCBI-GeneID: 100689403
NCBI-ProteinID: NP_001233756
UniProt: Q63980
LinkDB
AA seq 393 aa
MPKKKPTPIQLNPTPDGSAVNGTSSAETNLEALQKKLEELELEEQQRNRLEAFLTQKQKV
GELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHE
CNSPYIVGFYGVFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL
REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHY
SVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELLFGCQVEGDAAETPPRPRTPGRPLSSY
GMDSRPPMAIFELLDYIVNEPPAKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLLVHAF
IKRSDAEEVDFAGWLCSTIGLNQPSTPTHAASI
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgcccaagaagaagccgacgcccatccagctgaacccgacccccgatggctcggcggtt
aacgggaccagctcggccgagaccaacctggaggccttgcagaagaagctggaggagctg
gagcttgaggagcagcagcgaaaccgtctggaggcctttctgacccagaagcagaaggtg
ggagaactgaaggatgatgactttgagaagatcagtgagctgggggccggcaacggtgga
gtggtattcaaggtctcccataagccgtctggcctagttatggccaggaagctaattcat
ctggagatcaaacccgcaatccggaaccagatcatccgggagctgcaggtgctgcatgag
tgcaactccccatacatcgtgggcttctatggggttttctacagtgacggcgagatcagc
atctgcatggaacacatggatggtgggtccttggatcaagttctgaagaaagctggaaga
attcctgagcaaattttaggaaaagttagcattgctgtgataaaaggcctgacatatctt
cgggagaagcacaagattatgcacagagatgtcaagccttccaatattctagtaaactcc
cgtggagaaatcaaactctgtgattttggggtcagcgggcaactaattgactccatggcc
aactcctttgtaggcacaagatcatacatgtcgcccgagagactccaggggactcactac
tccgtgcagtcggacatctggagcatggggctctctctggtggagatggcagttgggaga
taccccatccctcctcctgatgccaaggaactggagctgctgtttggatgccaggtggag
ggagatgcagccgaaacgccacccaggccgaggacccctgggaggccccttagctcatat
ggaatggacagccgacctcccatggcaatttttgagttgttggattatatagtcaatgag
cctcctgcaaaattgcccagtggagtattcagtctggagtttcaagattttgtgaataaa
tgcttaataaagaaccctgcagagagagcagatctaaagcagcttctggttcacgctttc
atcaagagatctgatgccgaggaagtagacttcgcaggttggctctgctccaccattggg
cttaaccagcccagcacaccaacccatgccgctagcatctga

KEGG   Cricetulus griseus (Chinese hamster): 100774204
Entry
100774204         CDS       T02813                                 

Gene name
Map2k2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2 isoform X2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04218  Cellular senescence
cge04270  Vascular smooth muscle contraction
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04613  Neutrophil extracellular trap formation
cge04620  Toll-like receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04929  GnRH secretion
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05132  Salmonella infection
cge05135  Yersinia infection
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100774204 (Map2k2)
   04012 ErbB signaling pathway
    100774204 (Map2k2)
   04014 Ras signaling pathway
    100774204 (Map2k2)
   04015 Rap1 signaling pathway
    100774204 (Map2k2)
   04370 VEGF signaling pathway
    100774204 (Map2k2)
   04371 Apelin signaling pathway
    100774204 (Map2k2)
   04066 HIF-1 signaling pathway
    100774204 (Map2k2)
   04068 FoxO signaling pathway
    100774204 (Map2k2)
   04072 Phospholipase D signaling pathway
    100774204 (Map2k2)
   04071 Sphingolipid signaling pathway
    100774204 (Map2k2)
   04024 cAMP signaling pathway
    100774204 (Map2k2)
   04022 cGMP-PKG signaling pathway
    100774204 (Map2k2)
   04151 PI3K-Akt signaling pathway
    100774204 (Map2k2)
   04150 mTOR signaling pathway
    100774204 (Map2k2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100774204 (Map2k2)
  09143 Cell growth and death
   04210 Apoptosis
    100774204 (Map2k2)
   04218 Cellular senescence
    100774204 (Map2k2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100774204 (Map2k2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100774204 (Map2k2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100774204 (Map2k2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100774204 (Map2k2)
   04620 Toll-like receptor signaling pathway
    100774204 (Map2k2)
   04650 Natural killer cell mediated cytotoxicity
    100774204 (Map2k2)
   04660 T cell receptor signaling pathway
    100774204 (Map2k2)
   04662 B cell receptor signaling pathway
    100774204 (Map2k2)
   04664 Fc epsilon RI signaling pathway
    100774204 (Map2k2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100774204 (Map2k2)
   04929 GnRH secretion
    100774204 (Map2k2)
   04912 GnRH signaling pathway
    100774204 (Map2k2)
   04915 Estrogen signaling pathway
    100774204 (Map2k2)
   04917 Prolactin signaling pathway
    100774204 (Map2k2)
   04921 Oxytocin signaling pathway
    100774204 (Map2k2)
   04926 Relaxin signaling pathway
    100774204 (Map2k2)
   04935 Growth hormone synthesis, secretion and action
    100774204 (Map2k2)
   04919 Thyroid hormone signaling pathway
    100774204 (Map2k2)
   04916 Melanogenesis
    100774204 (Map2k2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100774204 (Map2k2)
  09156 Nervous system
   04720 Long-term potentiation
    100774204 (Map2k2)
   04730 Long-term depression
    100774204 (Map2k2)
   04722 Neurotrophin signaling pathway
    100774204 (Map2k2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100774204 (Map2k2)
   05206 MicroRNAs in cancer
    100774204 (Map2k2)
   05205 Proteoglycans in cancer
    100774204 (Map2k2)
   05230 Central carbon metabolism in cancer
    100774204 (Map2k2)
   05231 Choline metabolism in cancer
    100774204 (Map2k2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100774204 (Map2k2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100774204 (Map2k2)
   05225 Hepatocellular carcinoma
    100774204 (Map2k2)
   05226 Gastric cancer
    100774204 (Map2k2)
   05214 Glioma
    100774204 (Map2k2)
   05216 Thyroid cancer
    100774204 (Map2k2)
   05221 Acute myeloid leukemia
    100774204 (Map2k2)
   05220 Chronic myeloid leukemia
    100774204 (Map2k2)
   05218 Melanoma
    100774204 (Map2k2)
   05211 Renal cell carcinoma
    100774204 (Map2k2)
   05219 Bladder cancer
    100774204 (Map2k2)
   05215 Prostate cancer
    100774204 (Map2k2)
   05213 Endometrial cancer
    100774204 (Map2k2)
   05224 Breast cancer
    100774204 (Map2k2)
   05223 Non-small cell lung cancer
    100774204 (Map2k2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100774204 (Map2k2)
   05022 Pathways of neurodegeneration - multiple diseases
    100774204 (Map2k2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100774204 (Map2k2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100774204 (Map2k2)
   05135 Yersinia infection
    100774204 (Map2k2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100774204 (Map2k2)
   05170 Human immunodeficiency virus 1 infection
    100774204 (Map2k2)
   05161 Hepatitis B
    100774204 (Map2k2)
   05160 Hepatitis C
    100774204 (Map2k2)
   05164 Influenza A
    100774204 (Map2k2)
   05163 Human cytomegalovirus infection
    100774204 (Map2k2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100774204 (Map2k2)
   05165 Human papillomavirus infection
    100774204 (Map2k2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100774204 (Map2k2)
   01522 Endocrine resistance
    100774204 (Map2k2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100774204 (Map2k2)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100774204 (Map2k2)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: STE group
  STE7 family
   100774204 (Map2k2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7
Other DBs
NCBI-GeneID: 100774204
NCBI-ProteinID: XP_027275081
LinkDB
Position
5
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLEELDLDEQQRKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKAQHKPSGLIMARKLIHLEIKPAVRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEDILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNCRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELAIGRYPIPPPDAKELEASFGRPVVDGADGEPHSVSPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPSGVFSSDFQEFVNKCLIKNPAERADL
KMLMNHAFIKHSEGEEVDFAGWLCRTLRLKQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctaccggcgctcaccatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaggcgaacctggtggacctgcagaagaag
ctagaggaattggacctggatgagcagcaaaggaagcgactggaggccttccttacccag
aaggccaaggtcggggaactcaaggacgatgactttgaaaggatctcagagctgggagct
ggcaatggtggtgtggtcactaaggcccagcataagccgtcaggcctcatcatggccaga
aagctgatccatctggagatcaaaccagccgtccgcaaccagatcatccgggagctgcag
gtgctgcatgagtgcaactcaccctacattgtgggcttctatggggctttctacagtgat
ggcgagatcagcatctgcatggagcacatggatggtggctcactggaccaggtgctcaag
gaggccaagcggatccctgaggacatcttggggaaggtcagcattgcggtactccgaggc
ctggcatacctccgtgagaagcaccagatcatgcacagagatgtgaagccctccaacatc
ctggtgaactgtcgcggtgagatcaagctgtgtgacttcggggtgagcggccagctgatt
gactccatggccaattcatttgtgggaacacgctcctatatgtctccagagcggctacag
ggcacgcattactctgtgcagtcggacatctggagcatgggactgtcgctggtggagctg
gccatcgggaggtaccccatccccccacctgatgccaaggaactagaggccagctttggc
cggcctgtggtcgatggcgcagacggagagccccatagtgtctcgccgaggcccaggccg
cctggacgccccatcagcggtcatgggatggacagccgacctgccatggccatctttgag
ctgctggactacattgtgaatgagccacctcccaagctgcccagtggtgtgttcagctcg
gacttccaggagtttgtgaataaatgcctcattaagaacccggcagagcgagcggatctg
aagatgctgatgaaccacgccttcatcaagcactccgagggggaggaggtggacttcgca
ggctggctgtgccgaaccctgcggctgaagcagcccagcacacccacgcgcactgcagtg
tga

KEGG   Cricetulus griseus (Chinese hamster): 103158537
Entry
103158537         CDS       T02813                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1-like isoform X2
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04218  Cellular senescence
cge04270  Vascular smooth muscle contraction
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04613  Neutrophil extracellular trap formation
cge04620  Toll-like receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04928  Parathyroid hormone synthesis, secretion and action
cge04929  GnRH secretion
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05132  Salmonella infection
cge05135  Yersinia infection
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103158537
   04012 ErbB signaling pathway
    103158537
   04014 Ras signaling pathway
    103158537
   04015 Rap1 signaling pathway
    103158537
   04370 VEGF signaling pathway
    103158537
   04371 Apelin signaling pathway
    103158537
   04668 TNF signaling pathway
    103158537
   04066 HIF-1 signaling pathway
    103158537
   04068 FoxO signaling pathway
    103158537
   04072 Phospholipase D signaling pathway
    103158537
   04071 Sphingolipid signaling pathway
    103158537
   04024 cAMP signaling pathway
    103158537
   04022 cGMP-PKG signaling pathway
    103158537
   04151 PI3K-Akt signaling pathway
    103158537
   04150 mTOR signaling pathway
    103158537
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103158537
  09143 Cell growth and death
   04114 Oocyte meiosis
    103158537
   04210 Apoptosis
    103158537
   04218 Cellular senescence
    103158537
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103158537
   04540 Gap junction
    103158537
   04550 Signaling pathways regulating pluripotency of stem cells
    103158537
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103158537
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103158537
   04620 Toll-like receptor signaling pathway
    103158537
   04650 Natural killer cell mediated cytotoxicity
    103158537
   04660 T cell receptor signaling pathway
    103158537
   04662 B cell receptor signaling pathway
    103158537
   04664 Fc epsilon RI signaling pathway
    103158537
   04666 Fc gamma R-mediated phagocytosis
    103158537
   04062 Chemokine signaling pathway
    103158537
  09152 Endocrine system
   04910 Insulin signaling pathway
    103158537
   04929 GnRH secretion
    103158537
   04912 GnRH signaling pathway
    103158537
   04915 Estrogen signaling pathway
    103158537
   04914 Progesterone-mediated oocyte maturation
    103158537
   04917 Prolactin signaling pathway
    103158537
   04921 Oxytocin signaling pathway
    103158537
   04926 Relaxin signaling pathway
    103158537
   04935 Growth hormone synthesis, secretion and action
    103158537
   04919 Thyroid hormone signaling pathway
    103158537
   04928 Parathyroid hormone synthesis, secretion and action
    103158537
   04916 Melanogenesis
    103158537
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103158537
  09156 Nervous system
   04725 Cholinergic synapse
    103158537
   04726 Serotonergic synapse
    103158537
   04720 Long-term potentiation
    103158537
   04730 Long-term depression
    103158537
   04722 Neurotrophin signaling pathway
    103158537
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103158537
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103158537
   05206 MicroRNAs in cancer
    103158537
   05205 Proteoglycans in cancer
    103158537
   05230 Central carbon metabolism in cancer
    103158537
   05231 Choline metabolism in cancer
    103158537
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103158537
  09162 Cancer: specific types
   05210 Colorectal cancer
    103158537
   05212 Pancreatic cancer
    103158537
   05225 Hepatocellular carcinoma
    103158537
   05226 Gastric cancer
    103158537
   05214 Glioma
    103158537
   05216 Thyroid cancer
    103158537
   05221 Acute myeloid leukemia
    103158537
   05220 Chronic myeloid leukemia
    103158537
   05218 Melanoma
    103158537
   05211 Renal cell carcinoma
    103158537
   05219 Bladder cancer
    103158537
   05215 Prostate cancer
    103158537
   05213 Endometrial cancer
    103158537
   05224 Breast cancer
    103158537
   05223 Non-small cell lung cancer
    103158537
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103158537
   05022 Pathways of neurodegeneration - multiple diseases
    103158537
  09165 Substance dependence
   05034 Alcoholism
    103158537
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103158537
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103158537
   05135 Yersinia infection
    103158537
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103158537
   05170 Human immunodeficiency virus 1 infection
    103158537
   05161 Hepatitis B
    103158537
   05160 Hepatitis C
    103158537
   05164 Influenza A
    103158537
   05163 Human cytomegalovirus infection
    103158537
   05167 Kaposi sarcoma-associated herpesvirus infection
    103158537
   05165 Human papillomavirus infection
    103158537
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103158537
   01522 Endocrine resistance
    103158537
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    103158537
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103158537
Protein kinases [BR:cge01001]
 Serine/threonine kinases: STE group
  STE7 family
   103158537
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr NAD_binding_6 DUF3216
Other DBs
NCBI-GeneID: 103158537
NCBI-ProteinID: XP_027290052
LinkDB
Position
Unknown
AA seq 198 aa
MEVEECRAECLSVLLVCADLGTPLGRTNLEALQKKLEELELDEQQQKRLEAFLTQKQKVG
ELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHEC
NSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIVVIKGLTYLR
EKHKIKHRGEKALPDVLF
NT seq 597 nt   +upstreamnt  +downstreamnt
atggaggtggaggaatgcagggcagagtgtctctctgttctgctggtctgtgctgacctc
ggtactcctttgggcaggaccaacctggaagccttgcaaaagaagctggaggagctggag
cttgatgagcagcagcagaagcgccttgaggcctttctgacccagaagcagaaggtggga
gaactgaaggatgatgactttgagaagatcagtgagctgggggccggcaatggtggagtg
gtattcaaggtctcccataagccgtctggcctagttatggccaggaagctaattcatctg
gagatcaaacccgcaatccggaaccagatcatccgggagctgcaggtgcttcatgagtgc
aactccccgtacatcgtgggcttctatggggctttctacagtgacggcgagatcagcatc
tgcatggaacacatggatggtgggtccttggatcaagttctgaagaaagctggaagaatt
cctgagcaaattttaggaaaagttagcattgttgtgataaaaggcctgacatatcttcgg
gagaagcacaagattaagcacagaggtgagaaagcattgccagatgttttattctga

KEGG   Cricetulus griseus (Chinese hamster): 113835540
Entry
113835540         CDS       T02813                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1-like isoform X1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04066  HIF-1 signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04114  Oocyte meiosis
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04218  Cellular senescence
cge04270  Vascular smooth muscle contraction
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04380  Osteoclast differentiation
cge04510  Focal adhesion
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04613  Neutrophil extracellular trap formation
cge04620  Toll-like receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04668  TNF signaling pathway
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04725  Cholinergic synapse
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04928  Parathyroid hormone synthesis, secretion and action
cge04929  GnRH secretion
cge04934  Cushing syndrome
cge04935  Growth hormone synthesis, secretion and action
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05132  Salmonella infection
cge05135  Yersinia infection
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113835540
   04012 ErbB signaling pathway
    113835540
   04014 Ras signaling pathway
    113835540
   04015 Rap1 signaling pathway
    113835540
   04370 VEGF signaling pathway
    113835540
   04371 Apelin signaling pathway
    113835540
   04668 TNF signaling pathway
    113835540
   04066 HIF-1 signaling pathway
    113835540
   04068 FoxO signaling pathway
    113835540
   04072 Phospholipase D signaling pathway
    113835540
   04071 Sphingolipid signaling pathway
    113835540
   04024 cAMP signaling pathway
    113835540
   04022 cGMP-PKG signaling pathway
    113835540
   04151 PI3K-Akt signaling pathway
    113835540
   04150 mTOR signaling pathway
    113835540
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113835540
  09143 Cell growth and death
   04114 Oocyte meiosis
    113835540
   04210 Apoptosis
    113835540
   04218 Cellular senescence
    113835540
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    113835540
   04540 Gap junction
    113835540
   04550 Signaling pathways regulating pluripotency of stem cells
    113835540
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    113835540
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    113835540
   04620 Toll-like receptor signaling pathway
    113835540
   04650 Natural killer cell mediated cytotoxicity
    113835540
   04660 T cell receptor signaling pathway
    113835540
   04662 B cell receptor signaling pathway
    113835540
   04664 Fc epsilon RI signaling pathway
    113835540
   04666 Fc gamma R-mediated phagocytosis
    113835540
   04062 Chemokine signaling pathway
    113835540
  09152 Endocrine system
   04910 Insulin signaling pathway
    113835540
   04929 GnRH secretion
    113835540
   04912 GnRH signaling pathway
    113835540
   04915 Estrogen signaling pathway
    113835540
   04914 Progesterone-mediated oocyte maturation
    113835540
   04917 Prolactin signaling pathway
    113835540
   04921 Oxytocin signaling pathway
    113835540
   04926 Relaxin signaling pathway
    113835540
   04935 Growth hormone synthesis, secretion and action
    113835540
   04919 Thyroid hormone signaling pathway
    113835540
   04928 Parathyroid hormone synthesis, secretion and action
    113835540
   04916 Melanogenesis
    113835540
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113835540
  09156 Nervous system
   04725 Cholinergic synapse
    113835540
   04726 Serotonergic synapse
    113835540
   04720 Long-term potentiation
    113835540
   04730 Long-term depression
    113835540
   04722 Neurotrophin signaling pathway
    113835540
  09158 Development and regeneration
   04380 Osteoclast differentiation
    113835540
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    113835540
   05206 MicroRNAs in cancer
    113835540
   05205 Proteoglycans in cancer
    113835540
   05230 Central carbon metabolism in cancer
    113835540
   05231 Choline metabolism in cancer
    113835540
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    113835540
  09162 Cancer: specific types
   05210 Colorectal cancer
    113835540
   05212 Pancreatic cancer
    113835540
   05225 Hepatocellular carcinoma
    113835540
   05226 Gastric cancer
    113835540
   05214 Glioma
    113835540
   05216 Thyroid cancer
    113835540
   05221 Acute myeloid leukemia
    113835540
   05220 Chronic myeloid leukemia
    113835540
   05218 Melanoma
    113835540
   05211 Renal cell carcinoma
    113835540
   05219 Bladder cancer
    113835540
   05215 Prostate cancer
    113835540
   05213 Endometrial cancer
    113835540
   05224 Breast cancer
    113835540
   05223 Non-small cell lung cancer
    113835540
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    113835540
   05022 Pathways of neurodegeneration - multiple diseases
    113835540
  09165 Substance dependence
   05034 Alcoholism
    113835540
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    113835540
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    113835540
   05135 Yersinia infection
    113835540
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    113835540
   05170 Human immunodeficiency virus 1 infection
    113835540
   05161 Hepatitis B
    113835540
   05160 Hepatitis C
    113835540
   05164 Influenza A
    113835540
   05163 Human cytomegalovirus infection
    113835540
   05167 Kaposi sarcoma-associated herpesvirus infection
    113835540
   05165 Human papillomavirus infection
    113835540
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    113835540
   01522 Endocrine resistance
    113835540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    113835540
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     113835540
Protein kinases [BR:cge01001]
 Serine/threonine kinases: STE group
  STE7 family
   113835540
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr DUF3216 NAD_binding_6
Other DBs
NCBI-GeneID: 113835540
NCBI-ProteinID: XP_027270576
LinkDB
Position
4
AA seq 225 aa
MGWCAGLVKPNGGAEPTCEVYLLSIRSLDESMNLCAENREKLPGGKSKGKLPRTNLEALQ
KKLEELELDEQQQKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVLKVSHKPSGLVM
ARKLIHLEIKPAIRNQIIRELQGLHECNSPDIVGFYGAFYSDGKISICMEHMDGGSLDQV
LKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRGEKALPDVLF
NT seq 678 nt   +upstreamnt  +downstreamnt
atgggttggtgtgctgggctggttaagcccaatggtggagcagagccaacctgcgaagtc
tacctcctcagcatcagatctcttgatgaaagcatgaacctgtgtgcagaaaacagggaa
aaactaccaggagggaaaagcaagggaaaactgcctaggaccaacctggaagccttgcaa
aagaagctggaggagctggagcttgatgagcagcagcagaagcgccttgaggcctttctg
acccagaagcagaaggtgggagaactgaaggatgatgactttgagaagattagtgagctg
ggggccggcaatggtggagtggtactcaaggtctcccataagccgtctggcctagttatg
gccaggaaactaattcatctggagatcaaacccgcaatccggaaccagatcatccgggag
ctgcaggggctgcatgagtgcaactccccggacatcgtgggcttctatggggctttctac
agtgacggcaagatcagcatctgcatggaacacatggatggtgggtccttggatcaagtt
ctgaagaaagctggaagaattcctgagcaaattttaggaaaagttagcattgctgtgata
aaaggcctgacatatcttcgggagaagcacaagattatgcacagaggtgagaaagcattg
ccagatgttttattctga

DBGET integrated database retrieval system