KEGG   Cricetulus griseus (Chinese hamster): 100689430Help
Entry
100689430         CDS       T02813                                 

Gene name
B4galt1
Definition
(RefSeq) beta-1,4-galactosyltransferase 1
  KO
K07966  beta-1,4-galactosyltransferase 1 [EC:2.4.1.22 2.4.1.90 2.4.1.38 2.4.1.-]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00510  N-Glycan biosynthesis
cge00514  Other types of O-glycan biosynthesis
cge00515  Mannose type O-glycan biosynthesis
cge00533  Glycosaminoglycan biosynthesis - keratan sulfate
cge00601  Glycosphingolipid biosynthesis - lacto and neolacto series
cge01100  Metabolic pathways
Module
cge_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
cge_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100689430 (B4galt1)
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100689430 (B4galt1)
   00515 Mannose type O-glycan biosynthesis
    100689430 (B4galt1)
   00514 Other types of O-glycan biosynthesis
    100689430 (B4galt1)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    100689430 (B4galt1)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100689430 (B4galt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cge01003]
    100689430 (B4galt1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cge04131]
    100689430 (B4galt1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cge04147]
    100689430 (B4galt1)
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     100689430 (B4galt1)
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     100689430 (B4galt1)
    2.4.1.90  N-acetyllactosamine synthase
     100689430 (B4galt1)
    2.4.1.-  
     100689430 (B4galt1)
Glycosyltransferases [BR:cge01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   100689430 (B4galt1)
Membrane trafficking [BR:cge04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100689430 (B4galt1)
Exosome [BR:cge04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100689430 (B4galt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Glyco_tranf_2_2 DEC-1_N
Motif
Other DBs
NCBI-GeneID: 100689430
NCBI-ProteinID: NP_001233620
UniProt: Q99PC2
LinkDB All DBs
AA seq 393 aa AA seqDB search
MRFLRPVLGGSAAMPGATLQRACRLLVAVCALHLGVTLVYYLSGRDLSRLPQLVGVSSTL
RSGTIGATANKQPPGARPPPPVGVSSKPRPGPDSSPGTAFDPGLKSNWTSVLVPPTTALL
TLPACPEESPLLVGPMVIDFNIAVDLELLAKKNPEIKMGGRYSPKDCISPHKVAIIIPFR
NRQEHLKYWLYYLHPVLQRQQLDYGIYVINQAGDTMFNRAKLLNIGFQEALKDHDYNCFV
FSDVDLIPMDDHNAYRCFSQPRHISVAMDKFGFSLPYVQYFGGVSALSKQQFLAINGFPN
NYWGWGGEDDDIFNRIVHKGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKET
MRFDGLNSLTYQVLNVERYPLYTKITVDIGTPR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttctgaggccggtcctgggcggcagcgccgcgatgccgggcgcgaccctgcag
cgggcctgccgcctgctcgtggccgtctgcgcgctgcacctcggcgtcaccctggtctat
tacctctcgggccgcgacctgagccgcctgcctcagctagtcggggtttcctctacactt
cggagcggcacgatcggcgccaccgccaacaagcagccccccggcgcgcggccgccgcct
cctgtgggagtctcctcgaagcctcgcccgggtcccgactccagccctggtacggctttt
gaccccggcctgaagagcaactggacttcggtcctagtgccccctaccactgcactgttg
acgctgcccgcttgccccgaggagtccccgctgctcgttggccccatggtgattgacttt
aatattgctgtggacctggagcttttggcaaagaagaacccagagataaagatgggcggt
cgttattcccccaaggactgtatttctcctcacaaggtggccatcattatcccatttcgc
aaccggcaggagcacctcaaatattggctgtattatttgcatccggtcctacagcgccag
caactggactatggtatctacgtcatcaaccaggctggagacaccatgttcaatcgagct
aagcttctcaacataggcttccaagaggccttgaaggaccatgactacaactgctttgtg
ttcagtgatgtggaccttattccaatggacgaccataatgcctacaggtgtttttcacag
ccccggcacatttctgttgcaatggacaagtttgggtttagcctgccttatgttcagtac
tttggaggcgtttctgccctcagtaaacaacagtttcttgccatcaatggatttcctaat
aattattggggctggggaggagaagatgatgacatttttaacagaatagttcataaggga
atgtctatatcacgcccaaatgctgtagttggaagatgtcgcatgatacgacactcaaga
gacaagaaaaatgagcccaatcctcagaggtttgaccggattgctcacacaaaggaaact
atgcgctttgatggtttgaactcacttacctaccaggtgttgaacgtagagagataccca
ttatataccaaaatcacagtggacatcgggacaccaagatag

KEGG   Cricetulus griseus (Chinese hamster): 100689434Help
Entry
100689434         CDS       T02813                                 

Gene name
B4galt2
Definition
(RefSeq) beta-1,4-galactosyltransferase 2
  KO
K07967  beta-1,4-galactosyltransferase 2 [EC:2.4.1.22 2.4.1.90 2.4.1.38 2.4.1.-]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge00510  N-Glycan biosynthesis
cge00514  Other types of O-glycan biosynthesis
cge00515  Mannose type O-glycan biosynthesis
cge00533  Glycosaminoglycan biosynthesis - keratan sulfate
cge00601  Glycosphingolipid biosynthesis - lacto and neolacto series
cge01100  Metabolic pathways
Module
cge_M00071  Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
cge_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100689434 (B4galt2)
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100689434 (B4galt2)
   00515 Mannose type O-glycan biosynthesis
    100689434 (B4galt2)
   00514 Other types of O-glycan biosynthesis
    100689434 (B4galt2)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    100689434 (B4galt2)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100689434 (B4galt2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cge01003]
    100689434 (B4galt2)
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     100689434 (B4galt2)
    2.4.1.38  beta-N-acetylglucosaminylglycopeptide beta-1,4-galactosyltransferase
     100689434 (B4galt2)
    2.4.1.90  N-acetyllactosamine synthase
     100689434 (B4galt2)
    2.4.1.-  
     100689434 (B4galt2)
Glycosyltransferases [BR:cge01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   100689434 (B4galt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_7N Glyco_transf_7C Glyco_tranf_2_2
Motif
Other DBs
NCBI-GeneID: 100689434
NCBI-ProteinID: NP_001233623
UniProt: Q80WN9 G3HFF7
LinkDB All DBs
Position
2
AA seq 369 aa AA seqDB search
MSRLLGGTLERVCKAVLLLCLLHFLVAVILYFDVYAQHLAFFSRFSIRSPAHALYPAASS
STNCSRPNATASSSGLPEVPSARPGPTAPVIPPCPDVPPGLVGRVVIEFTSPMPLERVQR
ENPGVLLGGRYTPPDCTPAQTVAVIIPFRHREHHLRYWLHYLHPMLRRQRLRYGIYVINQ
HGEETFNRAKLLNVGFLEALKEDATYDCFIFSDVDLVPMDDRNLYRCGDQPRHFAIAMDK
FGFRLPYASYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDVRI
GRYRMIKHDRDKHNEPNPQRFSKIQNTKLSMKWDGIGSLRYRVLEVSRQPLFTNITVDIG
RPMSWLNQG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagcagactgctgggggggacgctggagcgggtctgcaaggctgtgctccttctctgc
ctgctgcacttccttgtggctgtcatcctctactttgacgtctacgcccagcacctggcc
tttttcagccgcttcagtatccgaagcccagcccatgccctctaccctgcagccagcagc
agcaccaactgctctcggcccaatgccactgcctctagttctgggcttcctgaagtgccc
agtgcccggcctggccccacagctccagtcatcccaccctgtcctgacgtgccacctggt
cttgtgggccgagtggtcatcgagttcacctcacccatgcctctggagcgggtgcagagg
gagaacccaggcgtgctcctgggaggccgttatacaccacctgactgcaccccagcccaa
acagtggcagttatcatcccctttagacaccgggagcaccacctacgctattggctccac
tatctgcaccccatgttgaggcggcagcggctgcgctacggtatctatgtcatcaaccag
cacggtgaggagaccttcaaccgggccaagctgctcaacgtaggcttcctagaggcactg
aaggaggatgctacctatgactgtttcatcttcagtgatgtggacctggtccctatggat
gaccgcaatctgtaccgttgtggtgaccagccccgccactttgccatcgccatggacaag
tttggcttccggctgccctatgctagctactttggaggtgtgtcgggcctgagtaaggcc
cagtttctgaggatcaacggctttcctaacgagtactggggctggggcggtgaggacgat
gacatcttcaaccggatctccctgactgggatgaagatctcacgcccagatgtccggata
ggccgctaccgcatgatcaagcatgaccgggacaaacataacgagcccaaccctcagagg
tttagtaagattcaaaacacaaagctgagcatgaagtgggatggcattggatcgctgcgg
taccgagtcttggaagtgtctcggcagccactcttcaccaacatcacagtggacatcggg
cgacccatgtcatggctcaatcaaggctga

KEGG   Cricetulus griseus (Chinese hamster): 100758724Help
Entry
100758724         CDS       T02813                                 

Gene name
Lalba
Definition
(RefSeq) alpha-lactalbumin
  KO
K00704  alpha-lactalbumin [EC:2.4.1.22]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00052  Galactose metabolism
cge01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100758724 (Lalba)
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.22  lactose synthase
     100758724 (Lalba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys
Motif
Other DBs
NCBI-GeneID: 100758724
NCBI-ProteinID: XP_027251820
LinkDB All DBs
Position
2
AA seq 142 aa AA seqDB search
MMPFIPLILVCILFPAIQATQLTKCEVYQAMRDMDGHEGISSLEWTCIIFHSSGCDTQAT
VKNNGSTEYGLFQISNKHWCESSEIPESENICGISCDKFLDDDLTDDKMCAKKILAIKGI
DYWLAHKPLCSEKLEQWRCKKL
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgatgccttttattcctttgatcctggtgtgcattttgtttcctgccattcaggccaca
caactcacaaaatgtgaggtgtaccaggccatgagagacatggatggacatgaaggcatc
tcttcgcttgaatggacctgcattatattccacagcagtggttgtgacacacaagctaca
gtaaagaacaatggcagcacagagtacgggctcttccagatcagtaacaaacactggtgt
gagagtagtgagatccccgagtcagagaacatctgtggcatttcctgcgacaagttcctg
gatgatgaccttaccgatgacaaaatgtgtgccaagaagatcctggctatcaaagggatc
gactactggttggcacacaaacctctgtgctctgagaagctagaacagtggcgctgcaag
aaactgtga

DBGET integrated database retrieval system