KEGG   Cricetulus griseus (Chinese hamster): 100750381
Entry
100750381         CDS       T02813                                 

Definition
(RefSeq) interferon-inducible protein AIM2
  KO
K12966  absent in melanoma 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04621  NOD-like receptor signaling pathway
cge04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:cge00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100750381
   04623 Cytosolic DNA-sensing pathway
    100750381
SSDB
Motif
Pfam: HIN PYRIN DED
Other DBs
NCBI-GeneID: 100750381
NCBI-ProteinID: XP_027274726
UniProt: G3H811
LinkDB
Position
5
AA seq 352 aa
MENEYREILLLSGLDEIKEEELKRFKFLVPNEFEISRSRLEEATNRTELADQLIQSAGPA
SAVTKTIHIFRKLSYMHAANRLEEQKQKVDQRSKTTKKKGTQKVEKRSQDENCPGASATS
RDAASKKHSATEVCPQAKPQKTRVMAEQEAIREGLQKDPLALLVLKATIPFECETREGKQ
MIFHATVATETNFFFVKVLDAQFKDKFTPQRTIKISNYLWYNNFLEVTSSSTVVEADADH
QVCVPNNIKDKAGRTPMIKKLKTQPPGTIVNGIFKVQKIIEQRTDRVLYRIHDNTEEEMD
VLVLGNQNQVKCEEGDKLRLIFFEVSKSGEKIQLKSGPHSFFKVIKATKPKK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggagaatgaatatagagagatactgttgttgtccggcctggatgaaatcaaggaggag
gaactgaaacggttcaagttcttggtcccaaatgagtttgagatctcaaggagcagactg
gaggaggctacaaacaggacagagttagcggaccaactgattcagagtgcaggcccagca
tctgcggtgacaaagaccattcatattttccggaaattgagttatatgcatgctgcaaac
cgtcttgaggaacaaaagcagaaagttgatcaacgatccaaaactacaaagaagaaagga
acacagaaagtagaaaaaagaagtcaagatgaaaactgtcctggtgcctctgccaccagc
agagacgcagcctccaagaaacactctgctacagaagtctgtcctcaggctaagcctcag
aagacccgggtcatggcagaacaggaagccatcagagaaggtttacagaaggatcccctg
gctttgttggtgctgaaagctacgattcctttcgagtgtgaaactcgggaagggaagcaa
atgatattccatgcaacggtggccacagagacgaattttttctttgtaaaagttttagat
gcacagtttaaagataagtttaccccacagagaacaattaaaatatcaaactatctttgg
tacaataacttcttagaggtgaccagctcctcaactgtggttgaggctgatgctgaccac
caagtctgtgttccaaataacatcaaagataaagctgggagaactcccatgattaagaag
ctgaagactcagcctcctggaacaattgtgaatgggatttttaaagtccagaagataata
gagcaaagaacggatagagtcctatatagaatacatgacaacacagaggaggagatggac
gtgctggtgcttggaaaccagaaccaagtaaaatgcgaagaaggagataaacttagactc
atcttctttgaggtgtcaaaaagtggagagaaaatacagctgaaatcgggaccccacagc
ttctttaaggttattaaggccacaaagccgaaaaaatga

DBGET integrated database retrieval system