KEGG   Cricetulus griseus (Chinese hamster): 100750382
Entry
100750382         CDS       T02813                                 

Gene name
Axin2
Definition
(RefSeq) axin-2
  KO
K04385  axin 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05210  Colorectal cancer
cge05213  Endometrial cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100750382 (Axin2)
   04390 Hippo signaling pathway
    100750382 (Axin2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100750382 (Axin2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100750382 (Axin2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100750382 (Axin2)
   05225 Hepatocellular carcinoma
    100750382 (Axin2)
   05226 Gastric cancer
    100750382 (Axin2)
   05217 Basal cell carcinoma
    100750382 (Axin2)
   05213 Endometrial cancer
    100750382 (Axin2)
   05224 Breast cancer
    100750382 (Axin2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100750382 (Axin2)
   05022 Pathways of neurodegeneration - multiple diseases
    100750382 (Axin2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100750382 (Axin2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100750382 (Axin2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100750382 (Axin2)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100750382 (Axin2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind DUF4827 SdrD_B
Other DBs
NCBI-GeneID: 100750382
NCBI-ProteinID: XP_027281632
LinkDB
Position
7
AA seq 841 aa
MSSAVLVTLLPDPSSSFREDAPRPPVPGEEGETPPCQPSVGKGQSTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEVQA
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSTGGLGSLKVLCGYLPTLNEEEEWTCADLK
CKLSPTVVGLSSKTLRATASVRSTETVENGFRSFKRSEPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRMGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMAPVEPAAFAAELISRLEKLKLELESRHSLEKRLQQIREDEEKEGSEQALSSRDGAPVQ
HPLALLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHQHHQQYH
SLLPIGGKLSPVAACPLLGGKSFLSKQTTTKHVHHHYIHHHAVPKTKEEIEAEATQRVRC
LCPGGPEYYCYSKCKSHPKAPEPLPGEQFCGSKGSTLPKRNPKGTEPGLALPAREGGVSS
GSGAPQLPGEEGDRSQDVWQWMLESEWQSKSKPHSAQSIRKSYPLESARTSPGERVSQHH
LLGANGHPRSVTRAHPFTQDPAMPPLTPPNTLAQLKEACRRLAEVSKPPKQRCCVTSQQR
DRNHSATGQAGATTFSNPSLAPADHKEPKKLASVHTLQASELVVTYFFCGEEIPYRRVLK
AQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEVWDDETVLPMYEGRILGKVERI
D
NT seq 2526 nt   +upstreamnt  +downstreamnt
atgagtagcgctgtgttagtgactctccttccagatcccagcagcagcttccgcgaggat
gctccgaggcccccggttccgggggaagaaggggagaccccaccgtgtcagcccagtgtg
ggcaagggccagtccaccaaacctatgcctgtctcctccaatgctaggcggaatgaagat
gggctgggggagcccgaggggcgggcctcccctgattcccctctgaccaggtggaccaag
tctttgcactccttattgggcgaccaggatggtgcttacctcttccggactttcctggag
agggagaaatgtgtggataccctggacttctggtttgcctgtaatggattcaggcagatg
aacttgaaggataccaaaactctgcgagtagccaaagcaatctataagaggtacattgaa
aacaacagcattgtctccaagcagctgaaaccggccaccaagacctacatccgagatggc
atcaagaagcaacagatcgactccatcatgtttgaccaggcgcaaactgaggtccaagca
gtgatggaggaaaatgcctaccagatgtttttgacttcggacatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtactgggggattggggagcctaaaggtc
ctgtgtggctacctccccaccttgaatgaagaagaggagtggacttgcgccgatctgaag
tgcaaactttcacccactgtggttggcttgtccagtaaaactctgagggccacagcaagt
gtgagatccacggaaacggttgaaaatggattcaggtcattcaagagaagcgagccggtt
aatccttatcatgtaggttctggctatgtctttgcaccggccaccagtgccaatgacagc
gagatatccagcgacgcgttgactgatgactccatgtccatgacagacagtagcgtagat
ggaatccctccttatcgcatggggagtaagaaacagctccagagagagatgcaccgcagt
gtgaaggccaatggccaagtgtctctacctcattttccgagaacccaccgtctgcccaag
gagatggcacctgtggaacccgccgccttcgccgcggagctcatctccaggctggagaag
ctcaaactggagctggagagccgccacagcctggagaagcggctgcagcagatccgggag
gatgaagaaaaggaagggtctgagcaagcactgagctcccgggatggagcgccggtccag
caccccctggccctcctaccctcgggcagctatgaagaggacccgcagactatcctggac
gaccacctgtctagggtccttaagacccctggttgccagtcgcctggtgtgggccgctac
agcccacgttcccgctcccctgaccaccaccaccaccatcagcaccatcagcagtaccac
tccctcctcccgatcgggggcaagctgtccccagtggctgcttgcccactccttggaggc
aagagcttcctgagcaagcagacaacgacgaagcacgttcaccaccactacatccatcac
catgctgtccccaagaccaaggaggagattgaggcagaagccacgcagagagtgcgctgc
ctgtgtcctgggggccccgagtattattgctactccaaatgcaagagccaccccaaggct
ccagagcccctgcctggggagcagttttgtggcagcaaaggcagcaccttgcccaaacga
aatccaaaaggcacagaaccgggtctggcactgccggccagggaaggaggggtgtcgagt
ggatccggagcccctcagcttccaggggaggaaggagaccgttcgcaggatgtctggcag
tggatgctggagagtgagtggcagagcaagtccaagccccatagtgcccaaagcataaga
aagagctacccattggagtctgcccgcacatccccaggcgaacgagtcagccagcaccat
ctgttgggggccaacggacacccccgctcagtgacccgggctcacccatttacccaggat
cctgcaatgcctcccctcaccccacccaacactttggcacagctgaaggaagcctgccgc
aggctggcagaggtgtcaaaacccccaaagcagcggtgctgtgtgaccagtcagcagagg
gacaggaaccactcggccactggtcaggcaggagccacaaccttctctaacccaagcctg
gctccagcagatcacaaagagccaaagaagctggcaagtgtccacacgctccaggccagt
gagttggttgtcacttactttttctgcggagaagaaatcccatacaggagggtgctgaag
gcccagagcttgaccctgggccactttaaggagcagctcagcaaaaagggaaattatagg
tattacttcaaaaaagcgagtgatgagtttgcctgtggagcagtgttcgaggaggtctgg
gacgacgagacggtgctccccatgtatgaaggcaggatcctggggaaagtggagcggatc
gactga

KEGG   Cricetulus griseus (Chinese hamster): 100758169
Entry
100758169         CDS       T02813                                 

Gene name
Axin1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05210  Colorectal cancer
cge05213  Endometrial cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100758169 (Axin1)
   04390 Hippo signaling pathway
    100758169 (Axin1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100758169 (Axin1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100758169 (Axin1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100758169 (Axin1)
   05225 Hepatocellular carcinoma
    100758169 (Axin1)
   05226 Gastric cancer
    100758169 (Axin1)
   05217 Basal cell carcinoma
    100758169 (Axin1)
   05213 Endometrial cancer
    100758169 (Axin1)
   05224 Breast cancer
    100758169 (Axin1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100758169 (Axin1)
   05022 Pathways of neurodegeneration - multiple diseases
    100758169 (Axin1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100758169 (Axin1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100758169 (Axin1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100758169 (Axin1)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100758169 (Axin1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Rootletin
Other DBs
NCBI-GeneID: 100758169
NCBI-ProteinID: XP_027280931
UniProt: G3HBS5
LinkDB
Position
7
AA seq 863 aa
MNVQEQGFPLDLGTSFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGASTKSETSTAT
PRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQQIDPA
MFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMSGYLPT
LNEDEEWKCDQDADEDDGRDSVPPSRLTQKLLLETAAPRAPSSRRYSEGRELRYGSWREP
VNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGELPSGPMTSHKLPSGPAWHHFPPRYVDMGCSGLRDAHEENPESILDEHVQRVMRT
PGCQSPGPGHRSPDSGHVAKTAVLGGVTSGHGKHVPKLGLKLDTAGLHHHRHVHHHVHHN
SARPKEQMEAEAARRVQSSFSWGPETHGHAKPRSYSESTGTTPSSGDLAFGGKASAPSKR
NTKKAESAKNASAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGMRKQQAHES
SRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLEEEEK
RANKLPSKQRYVQAVMQRGRTCVRPACAPVLSVVPAVSDLELSETETKSQRKAGGGSAPP
CDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEE
VREDEAVLPVFEEKIIGKVEKVD
NT seq 2592 nt   +upstreamnt  +downstreamnt
atgaatgtccaggagcagggtttccccttggacctcggaacaagtttcaccgaagatgcc
ccccggcccccagtgcctggagaagagggagaactggtatctactgattcaaggcctgtt
aaccacagtttctgctctgggaaaggtgccagcactaaaagtgagacctcaacagctacc
ccaagacgttcagatctggatctgggatatgagcctgagggcagtgcctcccccacccca
ccatacttgaggtgggctgagtcactgcattccttattggatgaccaagatgggatcagc
ctgttcaggactttcctgaagcaggagggctgtgctgacctcctggacttctggtttgcc
tgcagtggcttcaggaagcttgagccttgtgactcaaatgaggagaagaggctgaagctg
gcaagagccatctatcgaaagtatatcctggatagcaatggcattgtgtccagacaaacc
aagccagccactaagagcttcataaaggactgtgtcatgaagcagcagatcgatcctgcc
atgtttgaccaggcacagacagaaatccagtccaccatggaggagaatacctacccttct
ttccttaagtctgacatttatttggaatacacaaggacaggctcagagagtccgaaggtt
tgcagtgaccagagctcagggtctgggacagggaaaggcatgtctggatacctgcctact
ttgaatgaagatgaagaatggaaatgtgaccaagatgcagatgaagatgatggccgagac
tctgtcccccccagcaggctcacccagaagctgctattggagactgctgccccgagggcc
ccctcaagtagacggtacagcgaaggcagagagctcaggtatggatcttggagggagcct
gtcaacccctactatgtcaactctggctatgccctggccccagccaccagcgccaatgac
agtgaacagcagagcctgtccagtgatgctgacaccctatcccttacggacagtagtgtg
gatggaatccccccatacaggattcgtaagcagcaccgaagggagatgcaagagagtgtc
caagtcaatgggcgggtgcctctacctcacattcctcgcacttaccgaatgccaaaggag
atccgggtagaaccacagaagtttgctgaagagcttattcaccggctagaagctgttcag
cgcactcgagaagctgaagagaagctggaggaacggctgaagcgtgtacgaatggaagaa
gaaggggaggatggtgaactgccttctggccccatgacaagtcacaagctgccttctggc
ccagcctggcaccatttcccaccccgctatgtggatatgggctgctccggactgcgggat
gctcatgaggagaatcctgagagcattctggatgagcatgtgcaaagggtcatgaggaca
cctggctgccagtcacctggtccaggccaccgctctcccgacagtgggcatgtagccaag
actgcagtactagggggtgtaacctccgggcatgggaagcatgttcctaagttggggttg
aagctggatacagctggcctgcaccaccataggcacgtccaccaccatgtccaccataat
tcagctagacccaaggagcaaatggaggctgaagctgcccgaagggtccagagcagcttc
tcatggggcccagaaacacatgggcatgccaagccccgcagctattcagagagcacaggc
accacccccagttctggggacttggcctttggtggtaaagctagtgcaccctccaaaaga
aacaccaagaaggctgaatctgcgaagaatgccagtgctgaggtacccagtaccacagag
gatgcagagaagaaccagaagatcatgcagtggatcattgagggtgagaaggagatcagc
agacacaggaaggcaggccatgggtcttctgggatgaggaagcagcaggcccatgaaagc
tccaggcccttgtccattgagcgtcctggggctgtgcacccctgggtcagtgctcagctc
cgaaactctgtccagccttctcatcttttcatccaagatcccacaatgccacccaatcca
gcccctaaccccctgacccagctggaagaggcccgcaggcgcttggaggaagaggagaag
agagccaacaagctgccctccaagcagaggtatgtgcaggcagtcatgcagcggggacgc
acctgtgtcaggccagcatgtgcaccggtgctgagtgtggtaccagccgtgtcggacttg
gaactctccgagacagagacaaaatcacagagaaaggcaggtggcgggagtgcaccccca
tgtgacagcattgttgtggcctactatttctgtggggaacccatcccctaccggaccctg
gtgaggggccgtgctgtcacgctgggccagttcaaggagctgctaaccaagaaggggagc
tacagatactactttaagaaagtgagtgacgagtttgactgtggtgtggtatttgaagaa
gtacgggaggacgaggcagtcttgcctgtctttgaagagaagatcattggcaaggtggaa
aaagtggactga

DBGET integrated database retrieval system