KEGG   Cricetulus griseus (Chinese hamster): 100750426
Entry
100750426         CDS       T02813                                 

Gene name
Btrc
Definition
(RefSeq) F-box/WD repeat-containing protein 1A isoform X1
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04114  Oocyte meiosis
cge04120  Ubiquitin mediated proteolysis
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04340  Hedgehog signaling pathway
cge04390  Hippo signaling pathway
cge04710  Circadian rhythm
cge05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100750426 (Btrc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100750426 (Btrc)
   04340 Hedgehog signaling pathway
    100750426 (Btrc)
   04390 Hippo signaling pathway
    100750426 (Btrc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100750426 (Btrc)
   04218 Cellular senescence
    100750426 (Btrc)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100750426 (Btrc)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100750426 (Btrc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cge04121]
    100750426 (Btrc)
   03036 Chromosome and associated proteins [BR:cge03036]
    100750426 (Btrc)
Ubiquitin system [BR:cge04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100750426 (Btrc)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     100750426 (Btrc)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 F-box WD40_like Nup160 F-box_5 DUF4508
Other DBs
NCBI-GeneID: 100750426
NCBI-ProteinID: XP_027262976
LinkDB
Position
3
AA seq 619 aa
MDPAEAVLQEKALKFMAAVPAGGYWRNNKKCSMPRSLWLGCSSLADSMPSLRCLYNPGTG
ALTAFQNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCARLCINQETVCLTSTAMKTENCV
AKTKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHG
HINSYLKPMLQRDFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWK
KLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDENAPPNSFYRALYPKIIQDIETIESNW
RCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSV
LCLQYDERVIITGSSDSTVRVWDVNAGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIA
VWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHK
RGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDG
KIKVWDLMAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDP
AAHAEPPRSPSRTYTYISR
NT seq 1860 nt   +upstreamnt  +downstreamnt
atggacccggcagaggcggtgctgcaggagaaagcgctcaagtttatggctgcagttccg
gctggtggatattggaggaataataaaaagtgctctatgcccaggtctctgtggctgggc
tgctccagcctggcggacagcatgccttcgctgcgatgcctgtataacccagggactggc
gcactcacagctttccagaattcctcagagagagaagactgtaataatggcgaaccccct
aggaagataataccagagaagaattcacttagacagacgtacaatagctgtgccaggctc
tgcataaaccaagagacagtatgtctgacaagcactgctatgaagactgaaaattgtgtg
gccaaaacaaaacttgccaatggcacttccagtatgattgtgcccaagcagcggaaactc
tcagcgagctatgagaaggaaaaggaactgtgtgtcaagtattttgagcagtggtcagag
tctgatcaagtggaatttgtagaacaccttatatcccaaatgtgtcattaccagcatggg
cacatcaactcctatctaaagcctatgctgcaaagggatttcataactgctctgccagca
cggggtctggaccatattgctgagaacattctgtcgtacttggacgccaaatcactgtgt
gctgctgagcttgtgtgcaaggagtggtaccgtgtgacgtcggatggcatgctatggaag
aagctcatcgagagaatggtcaggacagactctctgtggagaggcctggcagagcgcaga
gggtggggacagtacctattcaaaaacaagcctcctgatgagaatgctcctcccaactcc
ttttatagagcactttatcctaaaattatacaagatattgagacaatagaatcaaattgg
agatgtggacgacatagtttacagagaatccactgccgaagtgaaacaagcaaaggagtt
tactgtttacaatatgatgaccagaaaatagtaagcggccttcgagataacaccatcaag
atctgggataaaagcacattggaatgcaagcggattctcacaggccacacaggctctgtc
ctgtgtctccagtatgatgagagagtgatcataactggctcatcggattccactgtcaga
gtatgggatgtgaacgcaggtgagatgctaaacacattgatccaccattgtgaggctgtt
ctgcacttgcgtttcaataacggcatgatggtgacctgctccaaagatcgttccattgct
gtatgggatatggcctccccaactgacatcaccctaaggagggtgctggtgggacaccga
gctgccgtcaacgttgtagactttgatgacaagtacatcgtttctgcatctggagataga
accataaaggtatggaacacgagtacttgtgaatttgtaaggaccctaaatggacacaaa
cgaggcatcgcctgtttgcagtacagagacaggctggtggtgagtggctcatctgacaat
actatcagactgtgggacatagaatgcggtgcgtgtttacgtgtgttagaaggccatgag
gaattggtgcgctgtattcgatttgataacaaaaggatagtgagtggggcctatgatgga
aaaattaaagtgtgggatctcatggctgctttggacccccgtgctcctgcggggactctc
tgtctacggacgcttgtggagcattctggaagagttttccgactccagtttgatgaattc
cagattgtcagtagttcacatgatgacacaatcctcatctgggacttcctaaatgatcca
gctgcccacgctgaaccaccccgctccccttctcggacatacacctacatctccagataa

KEGG   Cricetulus griseus (Chinese hamster): 100753568
Entry
100753568         CDS       T02813                                 

Definition
(RefSeq) F-box/WD repeat-containing protein 11 isoform X2
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04114  Oocyte meiosis
cge04120  Ubiquitin mediated proteolysis
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04340  Hedgehog signaling pathway
cge04390  Hippo signaling pathway
cge04710  Circadian rhythm
cge05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100753568
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100753568
   04340 Hedgehog signaling pathway
    100753568
   04390 Hippo signaling pathway
    100753568
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100753568
   04218 Cellular senescence
    100753568
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100753568
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100753568
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cge04121]
    100753568
   03036 Chromosome and associated proteins [BR:cge03036]
    100753568
Ubiquitin system [BR:cge04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100753568
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     100753568
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 WD40_like F-box Nup160 DUF4508 Frtz Elongin_A
Other DBs
NCBI-GeneID: 100753568
NCBI-ProteinID: XP_027261296
LinkDB
Position
3
AA seq 509 aa
MERDSVIEDKTMELMISNGTSSVIVSRKRPSEGNYQKEKDLCIQYFDRWSESDQVEFVEH
LISRMCHYQHGHINSYLKPMLQRDFITVLPEQGLDHIAENILSYLEARSLCAAELVCKDW
QRVISEGKLWKKLIERKVRADPLWKALCERRGWVQYLFKNRPTDGPPNSYSFYRSLYPKI
TQDIETLESNWRCGRHNLQKIQYGFENRGVCCLQYDDDKIICGLRDSCIKIWDKTSLKCL
KVLTGHTGSVLCLQYEEPVIVTGSSDSTVKVWDVNTGTVLNTLIHHKEAVLHLRFSNGLM
VTCSKDCSIAVWNMASATDITLHSVLIGHLAAVNVVDFDNKYIVSASGDRTIKVWSTSTC
EFIRTLNGHKQALTCLQYRDRLVISGSSDNTIRLWDIECGTCLRVLEGHEELVRCIHFDN
KRIVSGAYDGKIKVWDLQAALDPQAAANTLCLFTLVKHSRCMFCLQFDKFQIISGSHDDT
ICIWDFLNVPPSAQNETLSPSRTYTCISR
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggagcgcgactcggtgattgaggacaagaccatggagctcatgataagtaacggaaca
tcatctgtgattgtctccagaaagaggccatcagaggggaactaccagaaagaaaaggac
ttgtgcattcagtactttgaccggtggtctgaatcagatcaggtggaatttgtggagcac
cttatctcacgaatgtgccattaccagcatggacatattaactcttacctgaagcccatg
ttgcagcgggactttatcactgtcttaccagaacaaggcttagatcacatagcagaaaac
atcctttcttatctggaagccaggtctctgtgtgcagcagagctggtgtgtaaagactgg
cagcgagtgatctcagaagggaagctgtggaagaagctgatcgagagaaaggtgcgcgct
gaccctctctggaaggccctctgcgaaagaagagggtgggttcagtacctgtttaagaac
cgacctacagatggtcctcccaattcatattcattttatagatcattgtacccaaagatt
acccaagacatagagaccttagaatcaaattggcggtgtggacgacataacttgcagaag
atccagtacggctttgaaaatagaggtgtttgctgtttgcaatacgatgatgacaaaatt
atctgtggcctccgagacagctgtatcaagatctgggataaaaccagcctgaaatgtttg
aaggtgctaacaggacacacgggctctgtcctctgcctccagtatgaagagccagtcatt
gtaactggttcttcagattcaacagtgaaagtctgggatgtgaacacaggtacagttctg
aatacactcatccatcacaaggaggctgtactgcacttacgcttcagcaatggactgatg
gtgacttgttccaaggactgttctattgctgtgtggaacatggcttctgccactgatatc
actttacatagtgtcctcattggccaccttgctgctgtcaatgtagtagactttgacaat
aaatacatcgtgtctgcctctggagacaggaccattaaagtgtggagcaccagcacttgt
gagttcattcgcactctgaatgggcataagcaggccctcacctgtctacagtaccgggac
cggctggttattagtggatcatcagataacaccatccggctatgggatattgaatgtggt
acctgtctaagagtcctagaggggcatgaagaattggtccgatgcattcattttgataac
aagaggattgtcagtggcgcctatgatgggaagattaaagtctgggacttgcaagctgct
cttgaccctcaggccgctgcaaacacattgtgtctgttcaccttggtgaaacactctaga
tgcatgttttgtctgcagtttgataagtttcagattatcagcggttcccatgatgacact
atttgcatttgggatttcttaaatgtgcctcccagtgcccagaatgagacactctctccc
tccagaacctacacctgtatctccagatag

KEGG   Cricetulus griseus (Chinese hamster): 100772242
Entry
100772242         CDS       T02813                                 

Gene name
Fbxw11
Definition
(RefSeq) F-box/WD repeat-containing protein 11 isoform X3
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04114  Oocyte meiosis
cge04120  Ubiquitin mediated proteolysis
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04340  Hedgehog signaling pathway
cge04390  Hippo signaling pathway
cge04710  Circadian rhythm
cge05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cge00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100772242 (Fbxw11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100772242 (Fbxw11)
   04340 Hedgehog signaling pathway
    100772242 (Fbxw11)
   04390 Hippo signaling pathway
    100772242 (Fbxw11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100772242 (Fbxw11)
   04218 Cellular senescence
    100772242 (Fbxw11)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100772242 (Fbxw11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100772242 (Fbxw11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cge04121]
    100772242 (Fbxw11)
   03036 Chromosome and associated proteins [BR:cge03036]
    100772242 (Fbxw11)
Ubiquitin system [BR:cge04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100772242 (Fbxw11)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     100772242 (Fbxw11)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160 DUF1513 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 100772242
NCBI-ProteinID: XP_027280997
LinkDB
Position
7
AA seq 529 aa
MEPDSVIEDKTIELMNTSVMEDQNEDESPKKSALWQISNGTSSVIVSRKRPSEGNYQKEK
DLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAE
NILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFK
NRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDDKI
ISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVL
NTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDD
KYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECG
ACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSG
RVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggagcccgactcggtgattgaggacaagaccatcgagctcatgaacacttcagttatg
gaagatcaaaatgaagatgagtccccaaagaaaagtgctctttggcagataagtaacgga
acatcatctgtgattgtctccagaaagaggccatcagaggggaactaccagaaagaaaag
gacttgtgcattaagtactttgaccagtggtctgaatcagatcaggtggaatttgtggag
caccttatctcacgaatgtgtcattatcagcatggacatattaactcttacctgaagccc
atgttgcagcgggactttatcaccgccttaccagaacaaggcttagatcacatagcagaa
aacatcctttcctacctggatgccaggtctctgtgtgcagcagagctggtgtgtaaagaa
tggcagcgagtgatctcagaagggatgctgtggaagaagctgattgagaggatggtgcgc
actgaccctctgtggaagggcctctcagaaagaagagggtgggatcagtacctgtttaaa
aacagacctacagatggccctcccaattcattttatagatcattgtacccaaagattatc
caggacatagagaccatagaatcaaattggcggtgtggacgacataacttgcagaggatc
cagtgccgctctgaaaatagtaaaggtgtttactgtttgcagtacgatgatgacaaaatt
atcagtggcctccgagacaactctatcaagatctgggataaaaccagcctggaatgtttg
aaagtgttaacgggacacacgggctctgtcctctgcctccagtatgacgagcgagtcatt
gtaactggttcttcagattcaacagtgagagtatgggatgtgaacacgggtgaagttctc
aacacactcatccatcacaatgaagctgtgctgcacttacgcttcagcaatggactgatg
gtgacttgttccaaggaccgttcgattgctgtgtgggatatggcttctgccactgatatc
actttacgtcgtgtcctggttggccaccgtgctgctgtcaatgtagtagactttgacgac
aaatacattgtgtctgcctctggagacaggaccattaaagtgtggagcacgagcacttgt
gagttcgttcgcactctgaatgggcataagcggggcatcgcctgtctgcagtaccgggac
cggctggttgttagtggatcatcagataacaccatccggctatgggatattgaatgtggt
gcctgtctaagagtcctagaggggcatgaagaattggtccgatgcatccgttttgataac
aagaggattgtcagtggcgcctatgatgggaagattaaagtctgggacttgcaagctgct
cttgaccctcgggccccggcaagcacattgtgtcttcgcaccttggtggaacactctgga
cgtgtgtttcgactgcagtttgatgagtttcagatcatcagcagttcccatgatgacact
attttgatttgggatttcttaaatgtgcctcccagtgcccagaatgagacacgctctccc
tccagaacctacacctatatctccagatag

DBGET integrated database retrieval system