KEGG   Cricetulus griseus (Chinese hamster): 100750488
Entry
100750488         CDS       T02813                                 

Gene name
Ikbkb
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit beta isoform X1
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01523  Antifolate resistance
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04062  Chemokine signaling pathway
cge04064  NF-kappa B signaling pathway
cge04068  FoxO signaling pathway
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04380  Osteoclast differentiation
cge04620  Toll-like receptor signaling pathway
cge04621  NOD-like receptor signaling pathway
cge04622  RIG-I-like receptor signaling pathway
cge04623  Cytosolic DNA-sensing pathway
cge04625  C-type lectin receptor signaling pathway
cge04657  IL-17 signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04668  TNF signaling pathway
cge04722  Neurotrophin signaling pathway
cge04910  Insulin signaling pathway
cge04920  Adipocytokine signaling pathway
cge04930  Type II diabetes mellitus
cge04931  Insulin resistance
cge04932  Non-alcoholic fatty liver disease
cge05010  Alzheimer disease
cge05132  Salmonella infection
cge05135  Yersinia infection
cge05142  Chagas disease
cge05145  Toxoplasmosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05171  Coronavirus disease - COVID-19
cge05200  Pathways in cancer
cge05206  MicroRNAs in cancer
cge05212  Pancreatic cancer
cge05215  Prostate cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100750488 (Ikbkb)
   04014 Ras signaling pathway
    100750488 (Ikbkb)
   04064 NF-kappa B signaling pathway
    100750488 (Ikbkb)
   04668 TNF signaling pathway
    100750488 (Ikbkb)
   04068 FoxO signaling pathway
    100750488 (Ikbkb)
   04151 PI3K-Akt signaling pathway
    100750488 (Ikbkb)
   04150 mTOR signaling pathway
    100750488 (Ikbkb)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100750488 (Ikbkb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100750488 (Ikbkb)
   04621 NOD-like receptor signaling pathway
    100750488 (Ikbkb)
   04622 RIG-I-like receptor signaling pathway
    100750488 (Ikbkb)
   04623 Cytosolic DNA-sensing pathway
    100750488 (Ikbkb)
   04625 C-type lectin receptor signaling pathway
    100750488 (Ikbkb)
   04660 T cell receptor signaling pathway
    100750488 (Ikbkb)
   04658 Th1 and Th2 cell differentiation
    100750488 (Ikbkb)
   04659 Th17 cell differentiation
    100750488 (Ikbkb)
   04657 IL-17 signaling pathway
    100750488 (Ikbkb)
   04662 B cell receptor signaling pathway
    100750488 (Ikbkb)
   04062 Chemokine signaling pathway
    100750488 (Ikbkb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100750488 (Ikbkb)
   04920 Adipocytokine signaling pathway
    100750488 (Ikbkb)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100750488 (Ikbkb)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100750488 (Ikbkb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100750488 (Ikbkb)
   05206 MicroRNAs in cancer
    100750488 (Ikbkb)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100750488 (Ikbkb)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100750488 (Ikbkb)
   05221 Acute myeloid leukemia
    100750488 (Ikbkb)
   05220 Chronic myeloid leukemia
    100750488 (Ikbkb)
   05215 Prostate cancer
    100750488 (Ikbkb)
   05222 Small cell lung cancer
    100750488 (Ikbkb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100750488 (Ikbkb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100750488 (Ikbkb)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100750488 (Ikbkb)
   04932 Non-alcoholic fatty liver disease
    100750488 (Ikbkb)
   04931 Insulin resistance
    100750488 (Ikbkb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100750488 (Ikbkb)
   05135 Yersinia infection
    100750488 (Ikbkb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100750488 (Ikbkb)
   05170 Human immunodeficiency virus 1 infection
    100750488 (Ikbkb)
   05161 Hepatitis B
    100750488 (Ikbkb)
   05160 Hepatitis C
    100750488 (Ikbkb)
   05171 Coronavirus disease - COVID-19
    100750488 (Ikbkb)
   05164 Influenza A
    100750488 (Ikbkb)
   05162 Measles
    100750488 (Ikbkb)
   05168 Herpes simplex virus 1 infection
    100750488 (Ikbkb)
   05163 Human cytomegalovirus infection
    100750488 (Ikbkb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100750488 (Ikbkb)
   05169 Epstein-Barr virus infection
    100750488 (Ikbkb)
   05165 Human papillomavirus infection
    100750488 (Ikbkb)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100750488 (Ikbkb)
   05142 Chagas disease
    100750488 (Ikbkb)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100750488 (Ikbkb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100750488 (Ikbkb)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100750488 (Ikbkb)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100750488 (Ikbkb)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo APH ubiquitin Glyco_hydro_65m Com_YlbF YrbL-PhoP_reg Med20
Other DBs
NCBI-GeneID: 100750488
NCBI-ProteinID: XP_027251078
LinkDB
Position
1
AA seq 757 aa
MSWSPSLPTQTCGVWEMKERLGTGGFGNVIRWHNQVTGEQIAIKQCRQELSPKNRDRWCL
EIQIMRRLNHPNVVASRDVPEGMQSLAPNDLPLLAMEYCQGGDLRRYLNQFENCCGLREG
PILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
VDIVVSEDLNGTVKFSSSLPFPNNLNSVLVERLEKWLQLMLMWHPRQRGTDPQYGPNGCF
RALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKTRIQEDTGILEKDQELLQEAGLV
LLPDKPATQCISDSKPNEGLTMDMDLVFLFDNSKITYETQITPRPQPESVSCILQEPKRN
LSFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNAMASMAQQLK
AKLDFFKTSIQIDLEKYKEQTEFGITSEKLLLAWKEMEQAVEQCGREDDVKRLVEKMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLRERPRDQRTDGDSQEMVRLLLQAIQS
FEKKVRVIYTQLSKTVVCKQKALELLPQVEDVVSRMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNVSRLSHPGQLMSQPSSACDSLPDSAKKSEELVAEAHALCTRLE
SMLQDTVKTQDHSFTTLDWSWLQMEDEERGGLEQVCD
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgagctggtcaccgtccctcccaacccagacatgtggggtttgggaaatgaaagaacga
cttgggactgggggatttggaaacgtcatccgatggcacaatcaggtgacaggcgaacag
attgccatcaagcagtgccgacaggagctcagccccaagaacagagatcgctggtgccta
gagatccagatcatgagaaggctgaaccatcccaatgtggtggcttcccgggatgttcca
gaggggatgcagagcttggcacctaacgatttacctctactggccatggagtactgccaa
ggaggagatctccgaaggtacttgaaccagttcgaaaactgctgtggcctgcgggaagga
cccatccttaccctgctgagtgacattgcatcggcacttagataccttcatgagaacagg
atcatccatcgggatctgaagccagaaaacatcgttctgcagcaaggagagcagcgatta
atacacaaaattattgatctaggatatgccaaggaactcgatcagggcagcctgtgcact
tcctttgtggggaccctgcaatacctggccccagagctgctggagcagcagaagtacact
gtgactgtcgactactggagctttggcaccctggcctttgagtgcatcactggcttccgg
ccctttcttcctaactggcagcctgtgcagtggcattccaaagtccggcagaagagtgaa
gtggacattgttgtcagtgaagatttgaatggaacagtgaagttttccagctctttaccc
ttccccaataatcttaacagtgtcctggtggaacgtctggagaagtggctgcagctgatg
ctcatgtggcaccctcgacaaaggggcacggatcctcagtacggccccaatggctgtttc
cgagcgctggatgacatcctcaacttgaagctggttcatatcttgaacatggtcacaggc
accattcatacataccctgtgacagaggatgagagtctgcagagcttaaaaaccaggatc
caggaagacacgggaatcctggagaaggaccaggagctcctgcaagaggcagggctggtg
ctgctcccagacaagcctgccactcagtgcatctcagacagcaagccaaatgagggcctc
acaatggacatggatcttgtttttctctttgacaacagtaaaattacctacgagactcag
atcacccccagaccccaacctgaaagcgttagctgtatccttcaggagcccaagcggaac
ctctctttcttccagctgaggaaagtgtggggccaagtctggcacagcatccaaacgctg
aaggaagactgcaaccggctccagcagggacaacgagctgccatgatgaatctccttcgg
aacaacagctgcctttccaagatgaagaacgccatggcctctatggcacaacagctcaag
gctaagttggatttctttaaaaccagcatccagattgacctggagaagtacaaagagcag
accgagtttgggatcacatcagaaaagctgctgctggcctggaaggaaatggagcaggct
gtggagcagtgtgggcgggaggatgacgtgaagcgtctggtggagaagatgatggccctg
cagactgatattgtggacttacagaggagcccgatgggtcggaagcaggggggcactctg
gatgacctagaggaacaagcgagggaactctatagaagactgagggagaggcctagagac
cagaggacagacggtgacagtcaggaaatggttcggctgctacttcaggcaatccaaagc
tttgagaagaaagtgcgcgtaatttatacacagctcagtaaaaccgtggtctgtaagcag
aaggcactggagttgctgccccaggtagaagacgtggtgagccgtatgaatgaggatgag
aagactgtggtccgccttcaggagaagcggcagaaggagctctggaacctcctgaagatt
gcctgtagcaaagtcagaggtccagtcagtggaagcccagatagcatgaatgtgtctcgg
cttagtcaccctggtcagctaatgtcccagccgtccagtgcctgtgacagcttacctgac
tcagccaagaaaagtgaagagctggtggctgaagcacacgccctctgcacccggctagaa
agtatgctgcaagacactgtgaaaacgcaagaccacagcttcacgactctagactggagc
tggttacagatggaggatgaagaaaggggtggcctggagcaggtctgtgactga

KEGG   Cricetulus griseus (Chinese hamster): 100754432
Entry
100754432         CDS       T02813                                 

Gene name
Chuk
Definition
(RefSeq) inhibitor of nuclear factor kappa-B kinase subunit alpha isoform X5
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01523  Antifolate resistance
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04062  Chemokine signaling pathway
cge04064  NF-kappa B signaling pathway
cge04068  FoxO signaling pathway
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04380  Osteoclast differentiation
cge04620  Toll-like receptor signaling pathway
cge04621  NOD-like receptor signaling pathway
cge04622  RIG-I-like receptor signaling pathway
cge04623  Cytosolic DNA-sensing pathway
cge04625  C-type lectin receptor signaling pathway
cge04657  IL-17 signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04668  TNF signaling pathway
cge04920  Adipocytokine signaling pathway
cge05010  Alzheimer disease
cge05132  Salmonella infection
cge05135  Yersinia infection
cge05142  Chagas disease
cge05145  Toxoplasmosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05171  Coronavirus disease - COVID-19
cge05200  Pathways in cancer
cge05212  Pancreatic cancer
cge05215  Prostate cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100754432 (Chuk)
   04014 Ras signaling pathway
    100754432 (Chuk)
   04064 NF-kappa B signaling pathway
    100754432 (Chuk)
   04668 TNF signaling pathway
    100754432 (Chuk)
   04068 FoxO signaling pathway
    100754432 (Chuk)
   04151 PI3K-Akt signaling pathway
    100754432 (Chuk)
   04150 mTOR signaling pathway
    100754432 (Chuk)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100754432 (Chuk)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100754432 (Chuk)
   04621 NOD-like receptor signaling pathway
    100754432 (Chuk)
   04622 RIG-I-like receptor signaling pathway
    100754432 (Chuk)
   04623 Cytosolic DNA-sensing pathway
    100754432 (Chuk)
   04625 C-type lectin receptor signaling pathway
    100754432 (Chuk)
   04660 T cell receptor signaling pathway
    100754432 (Chuk)
   04658 Th1 and Th2 cell differentiation
    100754432 (Chuk)
   04659 Th17 cell differentiation
    100754432 (Chuk)
   04657 IL-17 signaling pathway
    100754432 (Chuk)
   04662 B cell receptor signaling pathway
    100754432 (Chuk)
   04062 Chemokine signaling pathway
    100754432 (Chuk)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100754432 (Chuk)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100754432 (Chuk)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100754432 (Chuk)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100754432 (Chuk)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100754432 (Chuk)
   05221 Acute myeloid leukemia
    100754432 (Chuk)
   05220 Chronic myeloid leukemia
    100754432 (Chuk)
   05215 Prostate cancer
    100754432 (Chuk)
   05222 Small cell lung cancer
    100754432 (Chuk)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100754432 (Chuk)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100754432 (Chuk)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100754432 (Chuk)
   05135 Yersinia infection
    100754432 (Chuk)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100754432 (Chuk)
   05170 Human immunodeficiency virus 1 infection
    100754432 (Chuk)
   05161 Hepatitis B
    100754432 (Chuk)
   05160 Hepatitis C
    100754432 (Chuk)
   05171 Coronavirus disease - COVID-19
    100754432 (Chuk)
   05164 Influenza A
    100754432 (Chuk)
   05162 Measles
    100754432 (Chuk)
   05168 Herpes simplex virus 1 infection
    100754432 (Chuk)
   05163 Human cytomegalovirus infection
    100754432 (Chuk)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100754432 (Chuk)
   05169 Epstein-Barr virus infection
    100754432 (Chuk)
   05165 Human papillomavirus infection
    100754432 (Chuk)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100754432 (Chuk)
   05142 Chagas disease
    100754432 (Chuk)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100754432 (Chuk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100754432 (Chuk)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100754432 (Chuk)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100754432 (Chuk)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD APH
Other DBs
NCBI-GeneID: 100754432
NCBI-ProteinID: XP_027263045
LinkDB
Position
3
AA seq 745 aa
MERPPGLRPAAGGPWEMRERLGTGGFGNVCLYQHRELDIKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANIIKACDVPEELNFLINDVPLLAMEYCCGGDLRKLLNKPENCCGLKESQ
ILSLLCDIGSGIRYLHENKIIHRDLKPENIVLHDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNNLCSLIVEPMESWLQLMLNWDPQQRGGPIDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPCDESFHSLQSRIERETGISTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
VQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEERAIHYAEVGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPTDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTIMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGTVTSPASAWLPPMLADREHPLTRVVTPQDGETLAQMMEQNLNCLGHL
STIIREANEEQSRSMMSLDWSWLTE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccggccgcgggcggcccctgggagatgcgggagcgg
ctgggcaccggcggcttcgggaacgtctgtctgtaccagcaccgggaacttgatatcaaa
atagcaattaagtcttgtcgcctagagttaagtaccaaaaacagagagcgctggtgccat
gaaatccagatcatgaaaaagttgaaccatgcaaatatcataaaggcctgtgatgttccc
gaggaattgaattttttaattaatgacgtgcctcttctagcaatggagtactgttgtgga
ggagatctccggaagctactcaacaaaccagaaaattgttgtggacttaaagaaagccag
atactttctttactgtgtgacataggatctggaattcgatatttgcatgaaaacaaaatc
atacatcgagatctgaaacctgaaaatatagttcttcatgatgttggtgggaagataatg
cataaaataattgatttgggttatgccaaagatgttgatcaaggaagtctctgtacatct
tttgtgggaacattacagtatttggccccagagctctttgaaaataagccgtacacagcc
actgtggattattggagctttgggaccatggtgtttgaatgtattgccggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaagatccaaag
tgtatatttgcatgtgaagagatgaccggagaagttcggtttagtagccatttacctcaa
ccaaacaacctttgtagtttaatagtagagcccatggaaagctggctacaattgatgctg
aattgggacccacagcagagaggggggcctattgatcttactttgaagcagccaagatgt
tttgtattaatggatcatattctcaacttaaagatagtgcacatcctaaatatgacttct
gcaaaaatcatttcttttctgttaccatgtgatgaaagttttcattcactacagtctcgt
attgagcgtgaaacaggaataagtaccggttctcaagaacttctgtcagagacaggaatt
tctctggatcctcggaaaccagcctctcagtgtgttctagatggagttagaggctgtgat
agctacatggtttatttgtttgataaaagtaagactgtgtatgaaggaccatttgcatcc
agaagtttgtctgattgtgtaaattatattgttcaagacagcaagatacagcttccaatt
gtacagctgcgtaaagtatgggctgaagcagtgcactatgtatctggactaaaagaagat
tacagcaggctctttcagggacaaagagcggcaatgttaagtcttcttagatataatgct
aacttgacaaaaatgaagaatactttgatctcagcatcacagcaactcaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggagagatatagtgagcagatgacttac
gggatatcttcagaaaaaatgctgaaagcatggaaagaaatggaggaaagggctattcac
tatgctgaggttggtgtcattggataccttgaggatcaaattatgtctttgcacactgaa
atcatggaacttcagaagagcccctatggaagacgccaaggagacttgatggagtctctg
gaacagcgtgccattgatctctataagcagttaaagcacagacctacagatcactcatac
agtgacagcacggagatggtgaagatcattgtgcacactgtgcagagtcaggaccgagtg
ctcaaggagctgtttggtcatctgagcaagttgttgggctgtaagcagaagattattgat
ctactccccaaggtggaagtggccctcagtaacatcaaagaagctgacaataccatcatg
tttatgcagggaaagaggcagaaagaaatatggcacctccttaaaattgcctgtacacag
agttctgcccgctctcttgtaggatccagtctagaaggcacagtaacctctccagcttca
gcatggctgccccctatgttagcagaccgtgaacatcctctgacacgtgtggtaactcct
caagatggagagacgttagcacaaatgatggaacaaaatctgaactgtcttggccactta
agtactattattcgtgaagcaaatgaggaacaaagccgtagtatgatgagtcttgattgg
agttggttaacagaatga

KEGG   Cricetulus griseus (Chinese hamster): 100759762
Entry
100759762         CDS       T02813                                 

Gene name
Ikbkg
Definition
(RefSeq) NF-kappa-B essential modulator isoform X6
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01523  Antifolate resistance
cge04010  MAPK signaling pathway
cge04014  Ras signaling pathway
cge04062  Chemokine signaling pathway
cge04064  NF-kappa B signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04380  Osteoclast differentiation
cge04620  Toll-like receptor signaling pathway
cge04621  NOD-like receptor signaling pathway
cge04622  RIG-I-like receptor signaling pathway
cge04623  Cytosolic DNA-sensing pathway
cge04625  C-type lectin receptor signaling pathway
cge04657  IL-17 signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04668  TNF signaling pathway
cge04920  Adipocytokine signaling pathway
cge05132  Salmonella infection
cge05135  Yersinia infection
cge05142  Chagas disease
cge05145  Toxoplasmosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05162  Measles
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05168  Herpes simplex virus 1 infection
cge05169  Epstein-Barr virus infection
cge05170  Human immunodeficiency virus 1 infection
cge05171  Coronavirus disease - COVID-19
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05212  Pancreatic cancer
cge05215  Prostate cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05222  Small cell lung cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
cge05340  Primary immunodeficiency
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100759762 (Ikbkg)
   04014 Ras signaling pathway
    100759762 (Ikbkg)
   04064 NF-kappa B signaling pathway
    100759762 (Ikbkg)
   04668 TNF signaling pathway
    100759762 (Ikbkg)
   04151 PI3K-Akt signaling pathway
    100759762 (Ikbkg)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100759762 (Ikbkg)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100759762 (Ikbkg)
   04621 NOD-like receptor signaling pathway
    100759762 (Ikbkg)
   04622 RIG-I-like receptor signaling pathway
    100759762 (Ikbkg)
   04623 Cytosolic DNA-sensing pathway
    100759762 (Ikbkg)
   04625 C-type lectin receptor signaling pathway
    100759762 (Ikbkg)
   04660 T cell receptor signaling pathway
    100759762 (Ikbkg)
   04658 Th1 and Th2 cell differentiation
    100759762 (Ikbkg)
   04659 Th17 cell differentiation
    100759762 (Ikbkg)
   04657 IL-17 signaling pathway
    100759762 (Ikbkg)
   04662 B cell receptor signaling pathway
    100759762 (Ikbkg)
   04062 Chemokine signaling pathway
    100759762 (Ikbkg)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100759762 (Ikbkg)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100759762 (Ikbkg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100759762 (Ikbkg)
   05203 Viral carcinogenesis
    100759762 (Ikbkg)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100759762 (Ikbkg)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100759762 (Ikbkg)
   05221 Acute myeloid leukemia
    100759762 (Ikbkg)
   05220 Chronic myeloid leukemia
    100759762 (Ikbkg)
   05215 Prostate cancer
    100759762 (Ikbkg)
   05222 Small cell lung cancer
    100759762 (Ikbkg)
  09163 Immune disease
   05340 Primary immunodeficiency
    100759762 (Ikbkg)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100759762 (Ikbkg)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100759762 (Ikbkg)
   05135 Yersinia infection
    100759762 (Ikbkg)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100759762 (Ikbkg)
   05170 Human immunodeficiency virus 1 infection
    100759762 (Ikbkg)
   05161 Hepatitis B
    100759762 (Ikbkg)
   05160 Hepatitis C
    100759762 (Ikbkg)
   05171 Coronavirus disease - COVID-19
    100759762 (Ikbkg)
   05164 Influenza A
    100759762 (Ikbkg)
   05162 Measles
    100759762 (Ikbkg)
   05168 Herpes simplex virus 1 infection
    100759762 (Ikbkg)
   05163 Human cytomegalovirus infection
    100759762 (Ikbkg)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100759762 (Ikbkg)
   05169 Epstein-Barr virus infection
    100759762 (Ikbkg)
   05165 Human papillomavirus infection
    100759762 (Ikbkg)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100759762 (Ikbkg)
   05142 Chagas disease
    100759762 (Ikbkg)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100759762 (Ikbkg)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100759762 (Ikbkg)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100759762 (Ikbkg)
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10 ERM
Other DBs
NCBI-GeneID: 100759762
NCBI-ProteinID: XP_035306095
LinkDB
Position
X
AA seq 418 aa
MTLPCWMSKHLWKNQLSEMVQPSGGPAGDQDMQGEESSLGKPAMLQLPSEQGTPETLQRC
LEENQELRDAIRQSNQMLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDL
QRQREQVLKDLEHLKKCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQTLEGRM
RAVSEQVRQLESEREVLQQQHSVQVDQLRMQNQSVEAALRMERQAASEEKRKLAQLQAAY
HQLFQDYDSHIKSSKGMQLEDLRQQLQQAEEALVAKQELIDKLKEEAEQHKIVMETVPVL
KAQADIYKADFQAERHAREKLVEKKELLQEQLEQLQREYSKLKVGCHESARIEDMRKRHV
ETSQPPLLPAPAHHSFHLALPNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgacactgccttgttggatgagtaagcacctctggaagaatcagttgagtgaaatggtg
cagcccagtggtggcccagcaggggaccaggacatgcagggtgaagaatcttctctgggg
aagccggcaatgttacagctgccttcagagcagggtactcctgagaccctccagcgctgc
ctggaagagaaccaagagctcagagatgccatccggcagagcaatcagatgctaagggaa
cgctgtgaggagctgctgcattttcaggtcagccagcgggaggagaaggagttcctcatg
tgcaaattccaggaagccaggaagctggtggagagactgagcttggagaagcttgacctg
cagaggcagagggaacaggtcttaaaggatttggagcacctgaagaaatgccaacagcag
atggctgaggacaaggcctctgtgaaagcccaggtgacatcattgttaggggaactccag
gagagccagagtcgcttggaggctgccaccaaagaacgacaaactttagagggaaggatg
cgagcagttagtgagcaggttagacagctggagagtgagcgggaggtgctgcagcagcag
cacagcgtgcaggtggaccagctgcgcatgcagaaccagagtgtggaggctgccctgcga
atggagcgccaggctgcttcagaggagaagcggaagctggctcagttgcaagcagcgtat
catcagctcttccaagactatgacagccacatcaagagcagcaagggaatgcagctggaa
gatttgaggcaacagctccagcaagctgaggaggccctggttgccaaacaggaattgatt
gataaactgaaagaagaagctgagcaacacaagattgtgatggagactgtgccagtccta
aaggcccaggcggatatctacaaggctgacttccaagctgagaggcatgcccgggaaaag
ctggtggagaagaaggagcttttgcaggaacagctggagcagctgcagcgcgagtacagc
aagctgaaggttggctgccatgagtcagccaggattgaggatatgaggaagcgacatgta
gagacttcccagccccctttactccctgctccagctcaccactcctttcatctggctttg
cccaaccagcggagaagtcctcctgaggaaccacctgacttctgttgtcccaagtgccag
tatcaggcacctgatatggacactctacagatacatgtcatggagtgcatagagtag

DBGET integrated database retrieval system