KEGG   Cricetulus griseus (Chinese hamster): 100750563
Entry
100750563         CDS       T02813                                 

Gene name
Apc
Definition
(RefSeq) adenomatous polyposis coli protein isoform X2
  KO
K02085  adenomatosis polyposis coli protein
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04810  Regulation of actin cytoskeleton
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05213  Endometrial cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100750563 (Apc)
   04390 Hippo signaling pathway
    100750563 (Apc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100750563 (Apc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100750563 (Apc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100750563 (Apc)
   05206 MicroRNAs in cancer
    100750563 (Apc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100750563 (Apc)
   05225 Hepatocellular carcinoma
    100750563 (Apc)
   05226 Gastric cancer
    100750563 (Apc)
   05217 Basal cell carcinoma
    100750563 (Apc)
   05213 Endometrial cancer
    100750563 (Apc)
   05224 Breast cancer
    100750563 (Apc)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100750563 (Apc)
   05022 Pathways of neurodegeneration - multiple diseases
    100750563 (Apc)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100750563 (Apc)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100750563 (Apc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100750563 (Apc)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100750563 (Apc)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cge04812]
    100750563 (Apc)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100750563 (Apc)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100750563 (Apc)
Cytoskeleton proteins [BR:cge04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100750563 (Apc)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP APC_N_CC Arm APC_u13 APC_15aa Suppressor_APC JIP_LZII
Other DBs
NCBI-GeneID: 100750563
NCBI-ProteinID: XP_027256499
LinkDB
Position
2
AA seq 2860 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDETM
TSSGQIDLLERLKEFNLDSSFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPVGSFPRR
AFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSLQ
TDMTRRQLEYEARQIRAAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRVRQLLQSQAAE
AERSSQSKQEAASHEAERQHEGQGVAESSMATSGSGQSSSTRVDHETASVLSSSSTHSAP
RRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLLH
GNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETCW
EWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGRKATRGISSQE
LGQGLSGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSMK
GCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKES
TLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNVS
SLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMGA
VSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAE
LDAQHLSETFDNIDNLSPKASHRSKQRHKPNLYGDYVFDTNRHDDNRSDNFNTGNLTVLS
PYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGIGLSTYHSATENPGSSSKRGLQISST
AAQIAKVMEEVSAIHTSQEDRSSGATAEFHCVTDERNAARRSSASHTHANTYNFTKSENP
NRTCSMPYAKVEYKRSSNDSLNSVNSSDGYGRRGQMKPSIESYSEDDESKFCSYGQYPAD
LAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHVIEDEMKQN
EQRQPRSQNTSYPVYSENTDDKHLKFQPPHFGQQECVSPYRSRGTSGSETNRMGSSHAIN
QNVNQSLCQEDDYEDDKPTNYSERYSEEEQHEEEERPTNYSMKYNEEKHHVDQPIDYSLK
YATDISSSQKPSFSFSKNSSAQNTKTEHLSPSSENTSTPSSNAKRQNQLHPGSAQRNGQT
QKGTTCKVPSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCDPTTQEADSANALQ
IAERKENDVTPSTQDPASEVPAVSQSARTKPSRLQASGLSSESTRHKAVEFSSGAKSPSK
SGAQTPKSPPEHYVQETPLVFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSDL
PDSPGQTMPPSRSKTPPPPPQTVQTKRETPKNKVPAAEKRETGPKQTAVNAAVQRVQVLP
DADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETEPEQPE
ESNENQNKEVEKPDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKLAQTASKLPPP
VARKPSQLPVYKLLPSQNRLQAQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIES
PPNELAAGDGVRAGTQSGEFEKRDTIPTEGRSTDETQRGKISSMVIPDLDDSKAEEGDIL
AECINSAMPKGKSHKPFRVKKIMDQVQQASVTSSGTNKNQVDTKKKKPTSPVKPMPQNTE
YRTRVRKNTDSKVNVNAEETFSDNKDSKKQSLKNNPKDFSDKLPNNEDRVRGSFTFDSPH
HYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGKESKDSEAKVICHTEPTSSQ
QSASKSQASTKHPINRGQSKPVLQKQPTFPQSSKDLPDRGAATDEKLQNFAIENTPVCFS
RNSSLSSLSDIDQENNNNKENEPVKEAEPANSQGEPSKPQASGYAPKSFHVEDTPVCFSR
NSSLSSLSIDSEDDLLQECISSAMPKKKRPSRLKGDSEKQSPRNMGGILAEDLTLDLKDI
QRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAAACLSRQASSDSDSILSLKSGI
SLGSPFHLTPDQEDKPFTSNKGPRILKPGEKSTLEAKKIESENKGIKGGKKVYKSLITGK
IRSNSEISSQMKQPLQTNMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSPS
EGPTATTSPRGTKPSVKSELSPITRQTSQISGSNKGSSRSGSRDSTPSRPTQQPLSRPMQ
SPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTKQA
GLSKNASSIPRSESASKGLNQMNNGNGSNKKVELSRMSSTKSSGSESDRSERPALVRQST
FIKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSTHPSVQAG
GWRKLPPNLSPTIEYNDGRPAKRHDIARSHSESPSRLPINRAGTWKREHSKHSSSLPRVS
TWRRTGSSSSILSASSESSEKAKSEDEKHVSSMPGPRPLKENQPPTKGTWRKIKESEISP
TTMLSQTTSSGAANGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPPV
IDSVSEKGNSSTKDSKDTQGKQSVGSGSPVHTVGLENRLNSFIQVDAPEQKGTETKPGPS
NPVPAAETVETCIVERTPFSSSGSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSARPS
QIPTPVSSNTKKRDSKTDSTESSGAQSPKRHSGSYLVTSV
NT seq 8583 nt   +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaaacagctacagggaagtattgaagatgaaactatg
acttcttctggacagattgacttactagagcgtcttaaagaatttaacttagatagcagt
ttccctggagtgaaactacgctcaaaaatgtccctccgttcctatggaagtcgggaggga
tcggtgtcaagccgctcaggagagtgcagtcctgttcccgtaggatcatttccaagaaga
gcatttgtaaatggaagcagagaaagtactggatatttggaagagctcgaaaaagaaaga
tcattactccttgctgatcttgacaaagaagaaaaggaaaaagactggtattatgctcaa
cttcagaacctcacaaaaagaatagatagcctgcctttaactgaaaacttttccttacaa
acagatatgacaagaaggcaactggaatatgaagcaaggcagatcagggctgcaatggag
gagcagcttggcacctgccaggatatggagaagcgagcacagcgaagaatagccagaatt
cagcagatagaaaaggacatactccgtgtacggcagcttttacagtcccaagcagctgaa
gcagagaggtcatctcagagcaagcaggaagctgcctcccatgaagctgaacggcagcat
gaaggtcaaggagtggcagaaagcagcatggcaacttctggtagtggccagagttcatct
acacgagtggatcatgaaacagccagtgttttgagttctagcagcacacactctgctcct
cgaaggttgacaagtcatctggggaccaaggtggaaatggtgtattcattgttatcaatg
cttggtactcatgataaggatgatatgtcacgaactttgctagctatgtctagctcccag
gacagctgtatatccatgcggcagtctggatgtcttcctctcctcatccagcttttacat
ggcaatgacaaagactctgtattgttgggaaattcccggggcagtaaagaggctcgggcc
agggccagtgcagcactccacaacatcattcactcacagcctgatgacaagagaggcagg
cgtgaaatccgagtccttcatcttttggaacagatacgagcttactgtgaaacctgttgg
gagtggcaggaagcccatgaacaaggcatggaccaggacaaaaatccaatgccagctcct
gttgaacatcagatctgtcctgctgtgtgtgttctaatgaaactttcatttgatgaagag
catagacatgctatgaatgaacttggtaggaaggctacccggggcatttcatcacaggag
ctaggtcaggggctttcagggggactgcaggccattgcagaattgttacaggtggactgt
gagatgtatgggcttactaatgaccactacagtattactttaagacgatatgctggaatg
gctttgacaaacttgacctttggagatgttgccaacaaggctacattatgttctatgaaa
ggctgcatgagagcactcgtggcccagttaaaatctgaaagtgaagacttacagcaggtt
attgcaagtgttttgagaaatttgtcttggcgagcggatgtaaatagcaaaaagacattg
cgagaagttggaagtgtgaaagcattgatggaatgtgctttggaagttaaaaaggaatca
accctcaagagtgtcttgagtgccctatggaacctgtctgcacactgcactgagaataaa
gctgacatatgtgctgtggatggggcacttgcgtttttggtcggcactctcacttacaga
agccagacaaacactttagccattattgaaagtggaggtgggatattacggaatgtgtcc
agcttgatagctacaaatgaagaccacaggcaaatcctaagagagaacaattgcctacaa
actttattacagcacttgaaatctcacagcttgacaatagtcagtaatgcctgtggaact
ctgtggaatctctcagcaagaaacccaaaagaccaggaagctttatgggacatgggggca
gtgagcatgctcaagaacctcattcactcaaagcacaaaatgatcgccatgggaagtgct
gcggctctacggaatctcatggcaaacagacctgcaaagtataaggatgccaatattatg
tctcctggttcaagtttgccatctcttcatgttaggaaacaaaaagccctagaagcagag
ttagatgctcagcatttatcagaaacctttgacaatattgacaatttaagtcccaaggca
tctcatcgtagtaagcagagacacaagccaaatctttatggtgattatgtctttgacacc
aaccgacatgatgataataggtcagacaattttaatactggaaatttgactgttctttca
ccatatttaaatactacagtattgcccagctcttcttcatcaaggggaagtctagacagt
tctcgttctgaaaaagacagaagtttagagagagaacgaggtattggcctcagcacttac
cattcagcaacagaaaacccaggatcctcttcaaaacgaggtttgcagatctctagtact
gcagcccagattgccaaagtgatggaagaagtatcagccattcacacctcacaggaagac
agaagttctggagctaccgccgaattccattgtgtgacggatgagaggaacgcagcacga
agaagctctgcttcccatacacatgcaaacacttacaactttacaaagtcggaaaatcca
aataggacatgctctatgccttatgccaaggtggaatataagagatcttcaaatgacagt
ttaaatagtgtcaatagtagtgatggttatggtagaagaggtcaaatgaaaccctcaatc
gaatcctattctgaagatgatgaaagtaagttctgcagttatggtcagtatccagctgac
ttagcccataagatacatagtgcaaatcatatggatgataatgatggagaactggataca
ccaataaattacagtcttaaatattcagatgagcagttgaactctggaaggcagagtccc
tcacagaatgaaagatgggcaagaccgaagcatgtaatagaagatgaaatgaagcaaaac
gagcaaagacaaccaagaagccaaaacaccagttatcctgtctattccgagaacactgat
gacaaacacctcaaattccagccaccacattttggacaacaggaatgtgtttccccatat
aggtctaggggaaccagtggctcagaaacaaatcgaatgggttctagtcatgcaattaat
caaaatgtaaatcagtctttgtgtcaggaagatgactatgaagatgataagcctactaac
tacagtgaacgttattctgaggaagaacaacatgaagaagaagagagaccgacaaactat
agtatgaaatataatgaggaaaaacatcacgtggaccagcctattgattatagtttaaaa
tatgccactgacatatcttcctcacagaaaccatcgttttcattctcaaagaattcatca
gcacaaaacactaaaactgaacacctctctccaagcagtgagaatacatccacaccttca
tctaatgccaaaaggcagaatcagctacatccaggttcagcacaaagaaatggtcagact
caaaaagggaccacttgcaaagtcccctccatcaaccaagaaacaatacagacttactgt
gtagaagacacccccatatgtttctcaaggtgtagttccttatcatcgctgtcatcagct
gaggatgaaataggatgtgacccgacaacacaggaagcagactctgcgaatgctctgcag
atagcagagagaaaagagaatgatgtcactccatcaactcaagatcctgcaagtgaagtt
ccagccgtgtcccagagtgctagaaccaaacccagcagactccaggcttctggcttatct
tcagaatcaaccaggcataaggctgttgagttttcttcaggggccaagtctccctccaaa
agtggtgcgcagacgcccaaaagtcccccagaacactatgtccaggagactccacttgta
ttcagcagatgtacttctgtcagctcacttgacagttttgagagtcgttccattgccagc
tctgttcagagtgagccctgcagtggaatggtgagtggcattataagccccagcgatctt
ccagatagccctgggcagaccatgccaccaagcagaagcaaaacccctccaccccctcca
cagacagtccagactaagagagagacaccaaaaaataaagtccctgctgctgagaagaga
gagactggacctaagcagacagctgtgaatgctgctgttcagagagtccaggtccttcca
gatgctgacactctattgcactttgccacagaaagtactccagatgggttttcttgttca
tctagcctgagtgccctgagccttgatgagccattcatacagaaagatgtggaattaaga
ataatgcctccagttcaggaaaatgacaatgggaatgaaactgaaccagagcagcctgaa
gaatcaaatgaaaaccagaataaagaggtagaaaaacctgattctgaaaaggacttatta
gatgattcagatgatgatgatattgaaatattagaagaatgtattatttcagccatgcca
acaaagtcatcacgcaaagccaaaaagctagcccagactgcttcaaaattacctccgcct
gtggcaaggaaaccaagtcaactgcctgtgtacaaacttctaccatcacaaaacaggcta
caggcacaaaagcatgttagctttacaccaggagatgatatgccccgtgtatactgtgta
gaagggacacctataaacttttccaccgcaacatctttaagtgatctgacaatagaatcc
cctccaaatgagttggctgctggagacggagttagagcaggtacacagtcaggcgaattt
gaaaaacgagataccattcctacagagggaagaagtacagatgaaactcagagggggaaa
atctcatctatggttataccagacctggatgacagtaaagcagaggaaggagatattctt
gcagaatgtatcaattctgccatgcccaaaggaaaaagccacaagcctttccgagtgaaa
aagataatggaccaggtccaacaagcatcagtgacttcatctggaactaacaaaaatcaa
gtagacactaagaaaaagaagcctacttcaccagtaaagcccatgccacaaaatactgaa
tatagaacacgtgtgaggaagaatacagactcaaaagttaacgtaaatgctgaagaaact
ttctcagacaacaaagactcaaagaaacagagcttgaaaaacaaccccaaggacttcagt
gataagctaccaaacaatgaagacagagtccgaggaagcttcaccttcgattcaccgcat
cattacacccccattgaaggaactccttactgtttttcacgaaatgactctttgagttct
ctagattttgatgatgacgatgttgacctttccagggaaaaggccgagttaagaaagggg
aaagaaagtaaggattcagaagccaaagttatctgccacacagagccaacctcaagccaa
cagtcagctagtaagtcacaagctagtacaaaacatccaataaataggggacagtctaaa
ccagtacttcagaaacaacccactttcccccagtcctccaaagacttgccagatagaggg
gcagcaacagatgaaaagttgcagaattttgctattgaaaatactccagtttgcttttct
cgaaattcctctctgagttcccttagtgacatcgaccaagaaaacaacaataacaaagaa
aatgaaccagttaaagaagctgaacctgctaactcacaaggagaaccaagtaagcctcag
gcatctgggtatgcgcccaagtcatttcacgttgaagacacccctgtctgtttctcgaga
aacagctctctcagttctcttagcattgattctgaagatgacctgttgcaggaatgtata
agttctgcaatgccaaaaaagaaaaggccttcaagactcaagggagatagtgaaaagcag
agtcccagaaatatgggtggcatattagctgaagatctgacacttgacttgaaagatata
cagaggccagattcagaacatggtttatctcctgattcagaaaattttgactggaaagct
attcaggaaggtgcaaactccatagtaagtagtttgcatcaagctgctgctgctgctgcg
tgtttatctagacaggcttcctctgattccgattccattctgtcactgaaatcaggcatt
tccctggggtcaccttttcatcttacacctgatcaagaggacaaacccttcacaagtaat
aaaggcccgagaattctcaaacctggggagaaaagcacattagaagcaaaaaagatagaa
tctgaaaataaaggcatcaaaggtgggaaaaaagtttataaaagcttgattactggaaag
attcgatctaactcagaaatttccagccaaatgaaacagcccctccagacgaacatgcct
tcaatctcaagaggtaggaccatgattcatatcccaggggttcggaatagctcctcaagt
acaagccctgtttctaaaaaaggcccacccctcaagactccagcctccaaaagccctagt
gagggtccgacagccaccacttctcctagaggaaccaagccatcagtgaaatcagagctg
agccctattaccaggcaaacttcccaaatcagtgggtcaaacaaggggtcttctagatcc
ggatctagagactccactccctcaagacctacacagcaaccattaagtaggccaatgcag
tctccaggacgaaactctatctcccctggtagaaatggaataagccctcctaataaactg
tctcagctacccaggacatcatctcctagcactgcttcaaccaagtcctcaggctctggg
aaaatgtcctatacatcccctggcaggcagatgagccaacaaaaccttaccaaacaagca
ggcttatccaagaatgccagtagtatcccaagaagtgagtccgcatctaaaggactaaat
cagatgaataatggcaatgggtctaataaaaaggtagaactttctaggatgtcttcaact
aagtcaagtggaagcgaatcggatagatcagaaagacctgcattagtacgccagtctact
ttcatcaaagaagccccaagcccgaccctaaggaggaaactggaggaatccgcctcattt
gaatccctttctccatcttctagaccagattctcccaccagatcccaggcacaaacccca
gttttaagtccttcccttcctgatatgtctctgtccacacatccatctgttcaagctggt
ggatggcgaaagctcccacctaatctcagccccactatcgagtacaacgatggaagacca
gcaaagcgccatgatatcgctcgctcccattctgaaagtccttccagactgccaatcaac
cgggcaggaacctggaagcgtgagcacagcaaacactcctcatcccttcctcgggtgagc
acttggagaagaactggaagctcatcttctattctttctgcttcatcagagtccagtgaa
aaagccaaaagtgaggatgaaaagcatgtgagctccatgccaggccccagaccactgaaa
gaaaaccaaccacccacaaaaggcacatggaggaaaataaaagaaagtgaaatctctccc
acaaccatgctttctcagaccacttcctcaggtgctgccaatggtgctgaatcaaagact
ctgatttaccagatggcacctgctgtttctaaaacagaggacgtttgggtgagaattgag
gactgccccattaacaaccctagatctggaagatctcccacaggtaacacccccccagtg
attgacagtgtttcagaaaagggaaattcaagcactaaagattcaaaagatacccaggga
aaacaaagtgtgggcagtggcagtcctgtgcacaccgtgggtctggaaaaccgcctgaac
tcctttattcaggtagatgctccagaacagaaaggaactgagacgaagccagggccgagt
aaccctgtccctgcagcagagactgttgagacttgtatagtcgagcgtacccctttcagt
tcaagtggctccagcaaacacagttcacctagtgggactgttgctgccagagtgacgcct
tttaattacaaccccagcccgaggaaaagcagtgcagatagcacttcagcccggccatct
caaatccccacaccagtgagtagcaacacgaagaagcgagattcaaagacagacagcaca
gaatccagtggagcccaaagtcctaagcgccattctgggtcttacctcgtgacgtctgtt
taa

KEGG   Cricetulus griseus (Chinese hamster): 100767273
Entry
100767273         CDS       T02813                                 

Gene name
Apc2
Definition
(RefSeq) adenomatous polyposis coli protein 2 isoform X2
  KO
K02085  adenomatosis polyposis coli protein
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04810  Regulation of actin cytoskeleton
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05213  Endometrial cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100767273 (Apc2)
   04390 Hippo signaling pathway
    100767273 (Apc2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100767273 (Apc2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100767273 (Apc2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100767273 (Apc2)
   05206 MicroRNAs in cancer
    100767273 (Apc2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100767273 (Apc2)
   05225 Hepatocellular carcinoma
    100767273 (Apc2)
   05226 Gastric cancer
    100767273 (Apc2)
   05217 Basal cell carcinoma
    100767273 (Apc2)
   05213 Endometrial cancer
    100767273 (Apc2)
   05224 Breast cancer
    100767273 (Apc2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100767273 (Apc2)
   05022 Pathways of neurodegeneration - multiple diseases
    100767273 (Apc2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100767273 (Apc2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100767273 (Apc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100767273 (Apc2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cge03036]
    100767273 (Apc2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:cge04812]
    100767273 (Apc2)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100767273 (Apc2)
Chromosome and associated proteins [BR:cge03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100767273 (Apc2)
Cytoskeleton proteins [BR:cge04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     100767273 (Apc2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC APC_r Arm_APC_u3 Suppressor_APC Arm SAMP bZIP_1 HALZ
Other DBs
NCBI-GeneID: 100767273
NCBI-ProteinID: XP_027275165
LinkDB
Position
5
AA seq 2348 aa
MLKSLQSPLPRGVATPTPSAQAQYSRPPPPSLRPRAGPALSSSCGSMGLLGLLSLLHSAF
FGDQALQELKMTSSMASYEQLVRQVEALKAENTNLRQELRDNSSHLSKLETETSGMKEVL
KHLQGKLEQEARVLVSSGQTEVLEQLKALQTDISSLYNLKFQPPALGPEPAARTPEGSPV
HGSGPPKDGFGELSRATIRLLEELDQERCFLLSEIEKEEKEKLWYYSQLQGLSKRLDELP
HVDTQFSMQMDLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDKELLEAQ
DRVQQTEPQALLAVKPVAVEEDQEPEVPTHPEDGIPHPGNSKVEVVFWLLSMLATRDQED
TARTLLAMSSSPESCVAMRRSGCLPLLLQILHGTEAGAGGRAGTPGAPGAKDARMRANAA
MHNIVFSQPDQGLARKEMRVLHVLEQIRAYCETCWDWLQTRDSSPEGGAGGAPVPIEPQI
CQATCAVMKLSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRDPLNLALRRYAGMTLT
NLTFGDVANKATLCARRGCMEAIVAQLASESEELHQVVSSILRNLSWRADINSKKVLREV
GSMTALMECVLRASKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYRCQG
NSLAVIESGGGILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWN
LSARSPRDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKYQAAATAVSP
GTCVPSLYVRKQKALEAELDTRRLVHALGHLEKQGLPEAETASKKPLPPLRHLDGLVQDY
ASDSGCFDDDDAPSLAAAATTAEPTSPAVLSMFLGGPFLQGQALARSQPARQGGLEAEKE
AGGEAAVAAKAKAKLALAVARIDRLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSC
SPCRGTEGGRREVSSRAHPLLRLKAAHTSLSNDSLNSGSTSDGYCPREHMRPCPLAALAE
HREDPLRGQTRPSRLDLDLPSRAELPARDTATTNTRVRTIKLSPTYQHVPLRDGAAGMGI
RPLAGPGASPGTRKQAWIPADSLSKVPEKLVSSPLPAASKVLQKLVAQDGPMSLSRCSSL
SSLSSAGHAGPSQAGNLDDSDSSLEGLEEAGPGEAELDGVWRASGSTSLPVSIPAPHQGH
SRGLGVEDATPSSSSENCVQETPLVLSRCSSVSSLGSFESRSIASSIPSDPCSGLGSGTV
SPSELPDSPGQTMPPSRSKTPPAPAGQPETSQFSLQWESYVKRFLDIADCRERCQPPSEL
DAGSVRFTVEKPDENFSCASSLSALALHELYVQQDVELRLRPPACPEHAGGGGGHRWRDE
AAGRLDGPAPTGSRARSAADKELEVLRECLGAAMPARLRKVVSALVPGRRALPVPVYMLV
PAPAQDDDSGTDSAEGTPVNFSSAASLSDETLQGPSRDKPGGPGERQKLTGRAVPARQTH
RHRPKTAGAGTEHTRGAGRNRAGLELPLSRPQSARSNRDGWCQTRPRGDGALQSLCLTTP
TEEAVYCFYDSDEEPAATAPPPWQVSAIPRALKHEKPTGRKETPSRVSEPVTPPVRAQPR
LIVDETPPCYSSASSLSEPEASEQPFSHPGGRELATTKDPGPGSKRDSSPSPRAEEELLQ
RCNSLALPRYRTQVPGSRRRKPRAARSDVRPTEVPQKCREEVPGSDPASDLDSVEWQAIQ
EGANSIVTWLHQAAAKASLEASSESDSLLSLVSGLSAGSTLQSSKHRKVRKPGAEAGGNW
CPEKRDATSTKISRSRRFPSGPEKAKGTQKVVAGEPAMLRGRTVIYTARPASRAQSKGVS
GPCATPKKMGTSGTTQPETATKAPSPGQQRSRSLHRPGKISELAALSHPPRSATPPARLA
KTPSSNSSQTSPASQPLPRRSPLATPTAGPLPGPGGSPVPKSPARALLAKQHKTQKSPVR
IPFMQRPAKRGPPPLARPSPEPGSRGRAGAEGAPGARGGRLGLVRMASVRSSGSESSDRS
GFRRQLTFIKESPRLLRCRRSELSSADSPSSSSQATSPRRGRPALPAVFLCSSRCDELRA
SPKQPLAPQRSPQAKPGLASLAPRRTSSESPSRLPVRAPPRRPETVKRYASLPHISVACR
PDNAVSVPTTQVSTTRRGSDGETRPLPRVAAPGTTWRRIKDEDVPHILRSTLPATALPLR
GPSPEDSPAGTPQRKTSDAVVQTEDVAASTTNSSTSPSLESRDLPQAQASGPDVDGAVLA
KPTASAPFTHEGLSIVTGGFPTARHGSPSRAARVPPFNYVPSPMVVATAASDSALEKAPV
TSPASLLE
NT seq 7047 nt   +upstreamnt  +downstreamnt
atgctcaagagtctccagtcacccctccccagaggagtggcaacccctaccccgtctgcg
caggcgcaatactcccggcctcctcctccatccctgcggccgagggcggggcccgcgctg
tccagcagctgcggctccatggggcttttggggctcctaagcctcctgcactcagccttc
ttcggggaccaggcactgcaggagttgaagatgaccagctccatggcctcgtacgagcag
ctggtgaggcaggtggaggccttgaaggctgagaacacaaacttaaggcaggagctacga
gataactccagccacctctccaaactggagacagagacttcaggcatgaaggaggtcctg
aaacacctccagggcaagctggagcaggaggcgcgggtgctggtgtcctccgggcagaca
gaagtgttagaacaactgaaagctcttcagactgacatcagtagcctctacaacctaaag
ttccagcccccagccctgggcccagagcctgccgcccggaccccagagggaagcccagtg
catggctctggcccacccaaggacggtttcggggagttgagccgcgccaccatccgcttg
ctggaagaactggaccaggagcgatgcttcctgttgagcgagatcgagaaagaggagaag
gagaagctgtggtattactctcagctgcagggcctgtccaagcgcttggatgagctgcca
cacgttgacacgcagttttcgatgcagatggatctgatccggcagcagctggagttcgag
gcccagcatatccgctcgctgatggaggagcgcttcggcacctcggacgagatggtgcag
cgcgcacagatccgcgcttcacgcctggagcagattgacaaggagctgttggaggcccag
gaccgggtgcagcagacggaacctcaggctctgctggcagtgaagcctgtggcagtggag
gaggaccaggagccggaagtccccacgcaccctgaggatggcatccctcaccctggcaac
agcaaggtggaggtggtgttttggcttctatccatgttggcaacacgggaccaggaagat
acagctcgcacactgctggccatgtccagctcgccagaaagttgcgtagccatgcgccgc
tccggctgtctgccactgttgctccagatccttcatggcactgaggccggggctgggggg
cgtgcggggactcctggggcacccggtgccaaagatgcacgcatgcgcgccaacgcagcc
atgcacaacatcgttttctcccagccggatcagggcttggctcgcaaggagatgcgtgtg
ctgcacgtgctggagcagatccgggcctactgtgagacctgctgggactggctgcagacc
cgggacagcagccctgagggtggtgcaggaggcgcccctgtccccatcgagcctcagata
tgccaagctacctgtgcagtgatgaagctgtcctttgatgaagaataccgtcgggctatg
aatgagctggggggcctgcaggctgtggcagagctactgcaggtggactatgagatgcac
aagatgacccgggatccgctcaaccttgctctgcgccgctacgctggcatgaccctcacc
aatctcaccttcggagatgttgccaacaaggccacactgtgtgcccgccgaggctgcatg
gaagccatcgtggcccagctggcctctgagagtgaggagctgcatcaggttgtgtccagt
atccttcgcaatctgtcatggagagctgacatcaacagtaagaaggtgctgagggaagtc
ggtagcatgactgctcttatggaatgtgtgctgcgggcctccaaggagtccactctcaag
agcgtcctcagtgctttgtggaacctgtctgcacacagcacagagaacaaggcagccatt
tgccaagtggatggtgcgctgggtttcctggtgagcacgctcacctatcgttgccaaggg
aactccctggcagttattgagagtggcggtgggatcctgcgcaacgtgtcaagcctcatt
gccacccgagaggactacaggcaggtgctccgtgaccacaactgcctacaaaccctgctg
cagcacctcacgtcccacagcctgaccattgtgagcaatgcctgtggcacactctggaac
ctgtcggcccgcagcccccgggaccaggaactgctgtgggatctgggagctgttggcatg
ctgcgcaacctggtccactccaaacacaagatgatcgccatgggtagtgctgctgccctg
cggaacctgctggctcaccgccctgccaagtaccaggcagcggccacggccgtctccccg
ggcacctgcgtgcccagcctgtatgtccgcaaacagaaggctctggaagctgagttggac
acccggcgcctggtgcatgcgctcggccacttggagaagcagggtctgcctgaggcagag
accgcttcaaagaagcccctgccacccctccgccacctggacgggctggtgcaggactat
gcctctgactctggctgttttgatgacgatgacgcgccatccctggctgctgcagccacc
acagccgagcccaccagccccgcggtgctgtcaatgttccttggtggtccttttcttcag
ggccaggctctggcccgcagccaacctgcccgccagggtggcctagaagccgagaaagag
gctggcggggaggcagctgtagctgccaaagctaaggccaagctggcgttggccgtggct
cggatcgaccgactggtggaggacatctctgccctgcatacctcatcggatgacagcttc
agtctcagctcaggggaccctgggcaggaggcaccacgagaggggcgcgcccagtcttgc
tctccatgccggggcactgagggtgggcgacgtgaggtcagcagtcgggcgcacccacta
ttgaggctcaaggcggcccacaccagcctctctaatgacagcctgaacagtggcagcaca
agcgatgggtattgtccccgggaacacatgcggccatgcccactggctgcattggccgag
caccgggaggaccctttgcgggggcagactcggcccagtaggctggacctggacctgccc
agccgggctgaactgcccgcccgggacacggccaccactaatacccgtgtgcgtaccatc
aagctatccccaacctatcagcatgtgccactgcgtgatggtgccgccgggatgggcatc
agacccctcgctggaccaggagcctccccggggactcggaagcaggcgtggatacctgca
gatagcttgagcaaagtcccagagaaactggtgtcctctccactgcctgccgctagcaaa
gtgctacagaagctggttgcacaggatgggccaatgtccctctcgcggtgcagttcactg
tcctctctgtcttccgctggccatgctggtcccagccaggctgggaaccttgatgacagt
gactcatctctggagggactggaggaggctggcccaggtgaggcagagctggatggggtt
tggcgagcgtctgggtccacctctttacctgtttccatcccagccccccatcagggccac
agtcgaggtcttggggtggaggatgcaacaccttctagttcatctgagaactgcgtccag
gagacgcccttggtcctgagccgctgtagctcagtgagttctctgggcagcttcgagagc
cgctccattgccagctccatccccagtgacccgtgcagtgggctgggcagtggcaccgtg
agtcccagtgagctgcccgacagccccgggcagacgatgccaccgagccgcagcaagaca
ccaccggcgcctgccggccagcccgaaaccagccagttcagcctgcagtgggagagctat
gtgaagcgcttcctagatatcgcagattgtcgggagcgatgccagccgccctcagagctg
gatgcaggcagcgtccgcttcacagtggagaagccagatgagaacttctcctgtgcctcc
agcctcagtgcgctggccctgcacgagctgtacgtccagcaggacgtggagctgcgcctg
aggccaccagcctgcccagaacatgcagggggcggcgggggacaccgctggagggacgag
gctgctggccgcctagatggcccagcacccactggttctcgggctcggtcagcagctgat
aaagaactggaggtacttcgtgaatgtctgggggcagccatgcctgcccggctccgcaag
gtggtctctgctttagtgcctggccgccgtgcactgccagttcctgtgtacatgttagtg
cccgccccagctcaggatgatgactctggcactgactcggcagagggcacacctgtcaac
ttctccagtgcagcatcactcagtgacgagaccttacagggaccctccagggacaagcca
ggagggcctggagaaaggcagaaactcacaggccgagctgtccctgccaggcagacccat
aggcaccgtcccaagacagcaggtgctggtacagagcacacccgaggggctggtaggaac
cgggcagggttagaattacccctcagcaggccccagagtgctcgatctaacagggatggc
tggtgccagacccggccccgtggggatggtgccctgcagtcactgtgcctcaccacacct
acagaggaagctgtgtactgcttttatgactctgatgaggagccagcagccacagcacca
ccgccctggcaggtgtctgcaatcccacgggctcttaagcacgagaaacccacaggcaga
aaggagaccccatccagggtgtcagagcctgtcacaccacctgtgagggcccagcccaga
ctgattgtggatgagaccccaccctgctattcctcagctagctccctcagtgagcctgag
gcctctgaacagccattcagccatcccggaggccgggagctggcaaccaccaaggaccca
ggtccaggcagtaaacgggacagctctcctagtccaagggctgaggaggagctattgcaa
cgatgtaacagcttagccctgcccaggtaccggacccaggtacccgggtctcgtcgtcgg
aagcccagagctgcccgatctgatgtgcggcccactgaggtacctcagaaatgccgtgag
gaggtgcctggctctgacccagcctctgatttagacagtgttgagtggcaggccatccaa
gagggtgcaaattctatcgtcacatggctgcaccaggcggcagccaaggccagcctggag
gcgtcttctgagtctgactccctcttgtctctggtgtctgggctctcagcaggctccact
ttacagtcctccaaacacaggaaggtgcgaaagcctggggctgaagctgggggtaactgg
tgtccagagaaacgggatgcaacttccaccaagatcagtaggagtcgtcggtttcctagt
ggtcccgagaaggcaaagggtacccagaaagtagtggcaggggagccagccatgctccgg
ggtcggacagtgatctacacggccagaccagcctcccgggctcagtccaaaggagtttct
ggcccttgtgccacacctaagaagatggggacatctggtaccactcagccagaaactgcc
accaaagctcccagccctgggcaacagcgttcaaggagcctccaccggccaggtaagatc
tcggagctggcagccttgagtcatccgcccaggagtgcgacccctccagcccgccttgcc
aagactccatcctcaaactcatcacagacgtcgccagcatcccagcccctgcctaggagg
tcccctctggccactccaactgcagggcctcttcctggccctggagggtctccagtgccc
aagtcaccagcccgggcccttctggctaagcaacacaagacccagaagtcacctgtgcgg
atcccgttcatgcaaaggccagccaagcgagggccaccaccactggctaggccatcccca
gagcctggatccaggggcagagctggggctgagggggctcctggtgctcgtggtggccgc
ctgggcctagtgcgtatggcctcagtccgctccagtggcagcgagtcctcagaccgctca
ggcttccgcaggcagctaaccttcatcaaggaatccccgcgtctccttcgttgccgcagg
tcggagctgtcctctgcagactccccctcctccagctcccaggccacttctcctcgccgt
ggaaggcctgcactccctgctgttttcctctgctcctctcgctgtgatgagttgcgggca
tccccaaagcagcctctggcaccacagagatccccgcaggccaagccaggtcttgcttca
cttgcgcccaggcgcaccagctctgagagcccctcacgcctacctgtgcgggcacctccc
aggcggcctgagacagtcaagcggtatgcatccctgccacacattagcgtcgcatgcagg
ccagataacgctgtctctgtacccactacccaagttagtaccactcgccggggaagtgat
ggagagaccagaccactgcccagggtagctgcaccaggtaccacctggcgtcgtatcaag
gatgaagatgtcccccacatcctgcgtagcacattgcctgccactgccctgcctctccgg
ggcccatcacccgaggacagccctgctgggactccacaacgcaagaccagtgatgcagtg
gtacaaacagaggatgtggcggcctctacgaccaactccagcacatcacccagcctggag
agcagggatctgccacaggcccaggccagtggccccgatgttgacggagcagtcctcgcg
aagccaactgcctcagcgccgttcacccatgagggcctgagtatcgtcacgggcgggttt
cccacagccaggcatggctccccgagcagggctgcacgagttccccctttcaactatgtg
cccagtcctatggtggtggccacagcagccagtgactctgcattggagaaagcccctgta
acctctccagctagcctcctggagtag

DBGET integrated database retrieval system