KEGG   Cricetulus griseus (Chinese hamster): 100750571
Entry
100750571         CDS       T02813                                 

Definition
(RefSeq) signal transducer and activator of transcription 5B isoform X2
  KO
K11224  signal transducer and activator of transcription 5B
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04012  ErbB signaling pathway
cge04062  Chemokine signaling pathway
cge04217  Necroptosis
cge04630  JAK-STAT signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04917  Prolactin signaling pathway
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge05161  Hepatitis B
cge05162  Measles
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100750571
   04630 JAK-STAT signaling pathway
    100750571
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100750571
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100750571
   04659 Th17 cell differentiation
    100750571
   04062 Chemokine signaling pathway
    100750571
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100750571
   04935 Growth hormone synthesis, secretion and action
    100750571
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100750571
   05203 Viral carcinogenesis
    100750571
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100750571
   05220 Chronic myeloid leukemia
    100750571
   05223 Non-small cell lung cancer
    100750571
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100750571
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100750571
   05161 Hepatitis B
    100750571
   05162 Measles
    100750571
Transcription factors [BR:cge03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100750571
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100750571
NCBI-ProteinID: XP_027283934
LinkDB
Position
7
AA seq 786 aa
MAMWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLITQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERMSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAELIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFDSQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAADGYVKPQIKQVVPEFANASTDSGS
GATYMDQAPSPVVCPQAHYNMYSQNPDPVLDTDGDFDLEDTMDVARRVEELLGRPMDSQW
IPHAQS
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggcaatgtggatacaagctcagcagctccagggcgatgccctccatcagatgcaggcc
ctgtatggccagcatttccccatcgaggtgcgacactatttatcccagtggatcgaaagc
caagcctgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagcttcagaagaaggcagaacaccaggtgggggaagatggg
tttttgctgaagatcaagctggggcactatgccacacagctccagaacacatacgaccgc
tgccccatggagctggttcgctgcatccggcacattctgtacaatgaacagaggctggtc
cgggaagccaacaacgggagctctccagctggaagtctggctgatgccatgtcccagaag
caccttcagatcaaccagacatttgaggaactgcgtctgatcacgcaggacacggagaac
gagctgaagaagctgcagcagacccaagagtacttcatcatccagtatcaggagagcctg
cggatccaagctcagtttgcccagctggcccagctgaacccccaggagcgcatgagccgg
gagacagccctccagcagaagcaagtgtccctggaggcctggctgcagcgagaggcacag
acactgcagcagtaccgtgtggagctggctgaaaagcaccagaaaaccctgcagctgctg
aggaagcaacagaccatcatcctggatgacgagctgatccagtggaagaggcggcagcag
ctggccgggaacgggggtccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagctggctgagctcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatcccaggccccgtggaggagatgctggccgaggtcaacgccaccatc
acagacatcatctcagccctggtcaccagcacattcatcatcgagaagcaacctcctcag
gtcctgaagacccagaccaagttcgcagccaccgtgcgcctgctggtgggtgggaagctg
aacgtgcacatgaacccccctcaggtgaaggcgaccatcatcagtgagcagcaggccaag
tccctgctcaagaacgagaacacccgcaatgattacagcggcgagatcctgaacaactgt
tgtgtcatggagtatcaccaagccacaggcaccctcagcgcccacttcagaaacatgtcc
ctaaaacgaatcaagaggtctgatcgccgtggtgcagagtcggtgaccgaagagaagttc
acaatcctgtttgactcacagttcagcgtgggtggaaatgagctggtctttcaagtcaag
accttgtcgctcccagtggtggtgattgttcatggcagccaggacaacaatgcgacagcc
accgtcctctgggacaatgcctttgcagagcctggcagggtgccattcgctgtgcctgac
aaggtgttgtggccgcagctgtgtgaggctctcaacatgaaattcaaggcagaagtgcag
agcaaccggggcctgaccaaggagaacctagtgttcctggcacagaaattgttcaacagc
agcagcagtcacctcgaagactacaacagcatgtcggtgtcctggtcccagttcaaccgg
gagaacttgccaggacggaattacactttctggcagtggtttgacggtgtgatggaagtg
ttaaaaaagcatctcaagcctcactggaacgatggggccatcttgggtttcgtgaacaag
caacaggcccatgacctactcattaacaagccagatgggaccttcctgctgagattcagc
gattccgaaatcggaggcatcaccattgcttggaagtttgactctcaggaaagaatgttt
tggaatctgatgccttttaccactagagacttctccatccggtccctggctgaccgcttg
ggggacttgaattacctcatatatgtgtttcccgatcggccaaaggatgaagtatattct
aagtactacacaccagtcccatgcgagcctgccactgcaaaagccgctgatggatacgtg
aagccgcagatcaagcaagtggtccctgagtttgctaatgcatctacagattcggggagt
ggcgctacctacatggaccaggctccctctccagtagtgtgcccccaggctcactacaac
atgtactcacagaaccccgaccctgtccttgacacggatggagactttgatctggaagac
acgatggatgttgcacggcgcgtggaggaactcttaggccggcccatggacagccagtgg
atccctcacgcacagtcatga

KEGG   Cricetulus griseus (Chinese hamster): 100755571
Entry
100755571         CDS       T02813                                 

Definition
(RefSeq) signal transducer and activator of transcription 5A isoform X1
  KO
K11223  signal transducer and activator of transcription 5A
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04012  ErbB signaling pathway
cge04217  Necroptosis
cge04630  JAK-STAT signaling pathway
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04917  Prolactin signaling pathway
cge04933  AGE-RAGE signaling pathway in diabetic complications
cge04935  Growth hormone synthesis, secretion and action
cge05161  Hepatitis B
cge05162  Measles
cge05166  Human T-cell leukemia virus 1 infection
cge05200  Pathways in cancer
cge05203  Viral carcinogenesis
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100755571
   04630 JAK-STAT signaling pathway
    100755571
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100755571
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100755571
   04659 Th17 cell differentiation
    100755571
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100755571
   04935 Growth hormone synthesis, secretion and action
    100755571
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100755571
   05203 Viral carcinogenesis
    100755571
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100755571
   05220 Chronic myeloid leukemia
    100755571
   05223 Non-small cell lung cancer
    100755571
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100755571
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100755571
   05161 Hepatitis B
    100755571
   05162 Measles
    100755571
Transcription factors [BR:cge03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100755571
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100755571
NCBI-ProteinID: XP_027283932
UniProt: G3HLW8
LinkDB
Position
7
AA seq 793 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRGQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNCSSPAGALADAMSQKHLQINQTFEELRLITQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERMSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAELIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSSHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFAKYYTPVLAKAVDGYVKPQIRQVVPEFINASADAGANATYM
DQAPSPVVCPQPHYNMYPQNPDPALDQDGEFDLDETMDVARHVEELLRRPIDSLDSRLSP
PAGLFTAARGSLS
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggcgggctggattcaggcccagcagctgcagggcgatgcgctgcgccagatgcaagtg
ctctacgggcagcatttccccatcgaggtccggcactacctggcccagtggatcgagagt
cagccctgggatgccattgacttggacaatccccaggaccgaggccaggccacccagctt
ctggagggcttggtgcaggagcttcagaagaaagcagaacaccaggtgggggaagatggg
tttttgctgaagatcaagctggggcactatgcaacacagctccagaacacctatgaccgc
tgccccatggagctggttcgctgtatccggcacattctgtacaatgaacagaggctggtc
cgagaagccaacaactgcagctcccctgctggtgccctggctgatgccatgtcccagaag
caccttcagatcaaccagacgtttgaggagctgcgtctgatcacgcaggacacggagaac
gagctgaagaagctgcagcagacccaagagtacttcatcatccagtatcaggagagcctg
cggatccaagctcagtttgcccagctggcccagctgaacccccaggagcgcatgagccgg
gagacagccctccagcagaagcaagtgtccctggaggcctggctgcagcgagaggcacag
acactgcagcagtaccgtgtggagctggctgaaaagcaccagaaaaccctgcagctgctg
aggaagcaacagaccatcatcctggatgacgagctgatccagtggaagaggcggcagcag
ctggccgggaacgggggtccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagctggctgagctcatctggcagaaccggcagcagatccgcagggctgagcacctctgc
cagcagctgcccatcccaggccccgtggaggagatgctggccgaggtcaacgccaccatc
acagacatcatctcagccctggtcaccagcacattcatcatcgagaagcaacctcctcag
gtcctgaagacccagaccaagttcgcagccaccgtgcgcctgctggtgggtgggaagctg
aacgtgcacatgaacccccctcaggtgaaggcgaccatcatcagtgagcagcaggccaag
tccctgctcaagaacgagaacacccgcaatgagtgcagcggtgagatcctgaacaactgt
tgtgtcatggagtatcaccaagccacaggcaccctcagcgcccacttcagaaacatgtca
ctgaaaagaatcaagcgtgctgacaggcgtggtgcagagtccgtgacggaggagaagttc
acagtcctatttgagtctcagttcagtgttggcagcaatgagctggtgttccaggtgaag
accctgtccctcccggtggttgtcatcgttcacggcagccaggaccacaatgctactgcc
actgtactgtgggacaatgccttcgctgagccgggcagggtgccgttcgctgtgcctgac
aaggtgctgtggccgcagctgtgtgaggctctcaacatgaaattcaaggcagaagtgcag
agcaaccggggcctgaccaaggagaacctagtgttcctggcacagaaactgttcaacagc
agcagcagccatctagaggactacaacagcatgtcggtgtcctggtcccagttcaaccgg
gagaacctgccaggctggaactacactttctggcagtggtttgacggggtgatggaggtg
ctgaagaaacaccacaagccccactggaatgatggggccatattaggctttgtgaataag
caacaggctcatgacctgctcatcaacaagccagatgggacctttctactgcgctttagc
gactcagaaatcggaggcatcaccattgcctggaagtttgactctcctgaccgaaacctc
tggaatctgaagccattcaccacgagagatttctccatacggtccctggctgaccggctg
ggggacctgagctacctcatctacgtgttcccagaccgacccaaggatgaggtctttgcc
aagtactacactcctgtacttgcaaaagctgtagatggatacgtgaagccgcagatcaga
caagtggtcccagagtttatcaacgcatctgccgatgctggagccaatgctacctacatg
gaccaggccccttccccagtcgtgtgtccccagcctcactacaacatgtacccacagaac
cctgaccctgccctcgaccaagatggagaatttgacctggatgagaccatggatgttgcc
agacacgtggaggagctcttacgaaggcccatagacagtctcgactcccgcctctcccca
cctgctggcctcttcaccgctgccagaggctccctgtcctga

DBGET integrated database retrieval system