KEGG   Cricetulus griseus (Chinese hamster): 100750732Help
Entry
100750732         CDS       T02813                                 

Gene name
Sdha
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00020  Citrate cycle (TCA cycle)
cge00190  Oxidative phosphorylation
cge01100  Metabolic pathways
cge01200  Carbon metabolism
cge04714  Thermogenesis
cge04932  Non-alcoholic fatty liver disease (NAFLD)
cge05010  Alzheimer disease
cge05012  Parkinson disease
cge05016  Huntington disease
Module
cge_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cge_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cge_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100750732 (Sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100750732 (Sdha)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100750732 (Sdha)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    100750732 (Sdha)
   05012 Parkinson disease
    100750732 (Sdha)
   05016 Huntington disease
    100750732 (Sdha)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100750732 (Sdha)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100750732 (Sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100750732
NCBI-ProteinID: XP_003513683
LinkDB All DBs
Position
Un
AA seq 664 aa AA seqDB search
MAGVAAVSRLLRGRRLALAGVRPATFQTQTCGFHFTVGESKKASAKVSDGISTQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACLTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRFDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLKHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDK
VPPIKANAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCEKIS
QLYGELKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
VDEYDYSKPIQGQQKRPFEEHWRKHTLSYVDNNTGKVTLEYRPVIDKTLNETDCATVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggctggcgttgcagcggtttcgcggcttcttcgcgggcgccgcttggcgctagctggg
gtgcggccagcaacattccaaacacagacctgtggctttcatttcactgttggtgaaagc
aagaaggcatctgccaaagtttcagatgggatttctactcagtacccagttgtggatcat
gaatttgatgctgtggtggtaggcgctggaggggcaggcttgagagctgcatttggactt
tctgaggcagggtttaatactgcatgccttacaaagctctttccgacccgatcacatact
gttgcagcacagggaggcatcaatgctgctctgggaaacatggaagaggacaactggaga
tggcatttctacgacaccgtgaaaggatctgactggcttggggatcaggatgccatccat
tacatgacagagcaagcccctgcctccgtggtcgagctagaaaattatggcatgccattt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
gggaaaggcgggcaggctcatcggtgttgctgtgtggctgatcgaacaggccactcactc
ttgcacaccttgtatggaaggtctctgagatttgacaccagctattttgtggagtatttt
gccttggatcttttgatggaaaatggggaatgccgtggtgtcattgcactgtgcatcgaa
gatgggtctatacaccgaataagagcaaagaacactgttattgctactgggggctatggg
cggacctacttcagctgcacatctgcccataccagcacaggggatggcacagctatggtc
accagggctggcttaccttgccaggacttagagtttgttcagttccaccccacaggtata
tatggtgctggctgtctcatcacagaagggtgccgtggagagggaggtattctcatcaac
agtcaaggtgaaaggttcatggagagatatgcccctgttgccaaggacctggcatccaga
gatgttgtatctcgatccatgactcttgagatccgtgaaggaagaggctgtggccccgag
aaagatcacgtctacctgcagttgcaccatctgccccctgagcagctggccacacgtctg
cctgggatttcagagacagccatgatcttcgctggcgtggatgtcactaaggagcctatc
cctgtcctccccactgtgcattacaacatgggtgggattcccactaactacaaagggcag
gtgctgaagcatgtgaatggacaggatcaggttgtgcctggcctgtatgcctgtggggag
gctgcctgtgcttcagtgcatggtgccaaccggcttggagcaaattccctattggacctc
gtagtctttggccgagcctgtgccctgagcattgcagaatcttgcaggcctggagataaa
gttcctccaattaaagcaaatgctggagaagagtcagttatgaatcttgacaagttaaga
ttcgctgatggaagcataagaacatcagaactacgcctcagcatgcagaagtcaatgcag
aatcatgctgcagtgttccgtgtgggaagtgtattacaagaaggctgtgaaaaaattagc
cagctatatggagaactgaagcatctaaagacatttgacagaggaatggtctggaacaca
gacctggtggagaccctggagctgcaaaacttgatgctgtgcgcactgcagaccatatat
ggtgcagaggcacgaaaggagtcacggggagctcacgccagggaagattataaagtgcgg
gttgatgagtatgattactccaagccaatccaggggcagcagaagaggccatttgaggaa
cactggaggaaacacaccctctcatatgtggacaacaacactgggaaggttactttggag
tacagacctgtcatcgacaagaccttgaatgaaactgactgtgccacagtaccccctgct
atccgttcctactga

DBGET integrated database retrieval system