KEGG   Cricetulus griseus (Chinese hamster): 100750837Help
Entry
100750837         CDS       T02813                                 

Gene name
Wbscr17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00512  Mucin type O-glycan biosynthesis
cge01100  Metabolic pathways
Module
cge_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100750837 (Wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cge01003]
    100750837 (Wbscr17)
Enzymes [BR:cge01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100750837 (Wbscr17)
Glycosyltransferases [BR:cge01003]
 O-Glycan biosynthesis
  Mucin-type
   100750837 (Wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 100750837
NCBI-ProteinID: XP_007618378
LinkDB All DBs
Position
Un
AA seq 498 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVIFLAKCRPIAVRSGDAFHEIRPRAEVHNLSVQAKCPVM
DVVFTKVSLLGDLVYLRNNGLSKSLGLIEGYGGRGKGGLPATLSPSEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSALGDSWELW
CMYISPPKDWWDAGDPSLPIRTQDMTGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRCLQNPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTI
AYGELRNNKAKDVCLDQGPLENHTAILYPCHGWGPQNGAIMNKGTGRCLEVENRGLAGID
LILRSCTGQRWTIKNSIK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgaggagagtcaaagtgttgttggtgttgaacttgatcgcggtggccggc
ttcgtgatctttttggctaagtgccggcctatcgcggtgcgcagcggagacgccttccac
gagatccggcctcgcgcagaggttcacaatttatcagtacaggcaaagtgcccagtcatg
gatgtggtgtttacaaaggttagtttattgggagacctagtttacttaaggaacaatggg
ttatccaaatcactcgggctcatcgaagggtatggtgggcgaggcaaaggaggccttcct
gccaccctttccccctctgaagaagaaaaagccaaaggacctcatgagaagtatggctac
aattcctacctcagcgaaaagatctccttggatcgatctattccagattatcgtcccact
aagtgtaaggagctcaaatactccaaggaattgccccagatatccatcatcttcatcttt
gtgaacgaggccctgtctgtgatcctgcggtcagtccacagcgctgtcaatcacacaccc
acacacctgctgaaggagatcatcctggtggatgacaacagcgatgaagaggagctgaag
gcccccttggaagagtatgttcacaaacgctaccctgggctggtgaaggtggtacgcaac
caaaagagagaaggcctgatccgagcacgcatcgagggctggaaggccgccactggccag
gtcactggcttttttgatgcccacgtggaattcactgctggctgggctgagcctgttctg
tcccgcatccaggagaaccggaagcgggtcatcctcccctccatcgacaacatcaaacag
gacaactttgaagtgcagcgctatgagaactctgcccttggggacagctgggagctttgg
tgcatgtacatcagccctccgaaagactggtgggacgccggagacccctctctccccatc
aggacacaggacatgactggctgctcatttgtggtcaacaggaaattctttggtgaaatt
ggtctgctggaccctgggatggatgtgtacggaggagagaatattgaactcggaatcaag
gtgtggctctgtggtggcagcatggaggtccttccttgctcaaggtgcttgcagaatcca
gggatcgatataggtgacgtctcagagagaaaagcattaaggaaaagtttgaagtgtaag
aatttccagtggtacttggaccacgtctacccggaaatgagaagatacaacaatactatt
gcatacggggagcttcgtaacaataaggccaaggatgtctgcctggatcaggggccacta
gagaaccacacagcaatactgtacccatgccacggctggggaccacagaatggagccatc
atgaataagggcacagggcgctgcctggaggtagagaaccggggcctggctggcattgac
ctcatcctcagaagctgtacaggacagaggtggacaatcaagaactccatcaagtag

DBGET integrated database retrieval system