Cricetulus griseus (Chinese hamster): 100750928 Help Entry 100750928         CDS       T02813                                  Name (RefSeq) interferon alpha-2-like   KO K05414   interferon alpha Organism cge  Cricetulus griseus (Chinese hamster) Pathway cge04060   Cytokine-cytokine receptor interaction cge04151   PI3K-Akt signaling pathway cge04217   Necroptosis cge04620   Toll-like receptor signaling pathway cge04621   NOD-like receptor signaling pathway cge04622   RIG-I-like receptor signaling pathway cge04623   Cytosolic DNA-sensing pathway cge04630   JAK-STAT signaling pathway cge04650   Natural killer cell mediated cytotoxicity cge04936   Alcoholic liver disease cge05152   Tuberculosis cge05160   Hepatitis C cge05161   Hepatitis B cge05162   Measles cge05163   Human cytomegalovirus infection cge05164   Influenza A cge05165   Human papillomavirus infection cge05167   Kaposi sarcoma-associated herpesvirus infection cge05168   Herpes simplex virus 1 infection cge05169   Epstein-Barr virus infection cge05170   Human immunodeficiency virus 1 infection cge05171   Coronavirus disease - COVID-19 cge05200   Pathways in cancer cge05320   Autoimmune thyroid disease cge05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:cge00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100750928    04151 PI3K-Akt signaling pathway     100750928   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100750928  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100750928  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100750928    04621 NOD-like receptor signaling pathway     100750928    04622 RIG-I-like receptor signaling pathway     100750928    04623 Cytosolic DNA-sensing pathway     100750928    04650 Natural killer cell mediated cytotoxicity     100750928  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100750928   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100750928    05161 Hepatitis B     100750928    05160 Hepatitis C     100750928    05171 Coronavirus disease - COVID-19     100750928    05164 Influenza A     100750928    05162 Measles     100750928    05168 Herpes simplex virus 1 infection     100750928    05163 Human cytomegalovirus infection     100750928    05167 Kaposi sarcoma-associated herpesvirus infection     100750928    05169 Epstein-Barr virus infection     100750928    05165 Human papillomavirus infection     100750928   09171 Infectious disease: bacterial    05152 Tuberculosis     100750928   09163 Immune disease    05320 Autoimmune thyroid disease     100750928   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100750928   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100750928  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cge04052]     100750928 Cytokines and neuropeptides [BR:cge04052]  Cytokines   Interferons    100750928 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  100750928 NCBI-ProteinID:  XP_027256316 UniProt:  A0A9J7JEY2 LinkDB All DBs Position 2:complement(59449923..59451344) Genome browser AA seq 215 aa AA seqDB search MGRELPECGTRQSMVHKSCGAWSPGPSEVWVLWSLLQRCCDKKNPYSLRSLQKKREKNLT SGAVIPVGAPHAALAYADGCKATRDFAFLLEKVDVQHIQKAQAIPVLQELTQQVLILFSS KDSSAAWETTLLDTFCTGLHQHLSDLQACLMQQVGEQEPPMSQEDSLVAVRKYFHRITVY LREKNHSPCAWEVVRAEVWRALSASGNMLLGRQPS NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggggcgggagctgcctgaatgcggaaccagacagtctatggtgcataagtcctgtggt gcttggagcccaggtccctctgaagtttgggtcctgtggagtttgttgcagagatgctgc gacaaaaaaaatccatactctcttagaagcttacagaaaaaaagagagaagaacctaacc agtggagcagtgattccagtgggagctccacatgcagctcttgcctatgccgatggctgc aaagccacaagagactttgcattccttctggagaaggtggatgtccagcacatccagaag gctcaagccatccctgtcctgcaggagctgacccagcaggtcctcatcctcttcagctca aaggactcatctgctgcttgggagacaacccttctagacacattctgcactggcctccac cagcatctcagtgacctgcaagcctgtctgatgcagcaggtgggggagcaggaacctccc atgagccaggaagactccctggtggctgtgaggaaatacttccacaggatcactgtctac ctgagagagaagaaccacagcccctgtgcctgggaggtggtcagagcagaagtctggaga gccctgtctgcctcaggcaacatgctgcttgggagacaaccctcctag

DBGET integrated database retrieval system