KEGG   Cricetulus griseus (Chinese hamster): 100751070
Entry
100751070         CDS       T02813                                 

Gene name
Trpv4
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 4 isoform X1
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04218  Cellular senescence
cge04750  Inflammatory mediator regulation of TRP channels
cge05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cge00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100751070 (Trpv4)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100751070 (Trpv4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100751070 (Trpv4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cge04040]
    100751070 (Trpv4)
Ion channels [BR:cge04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   100751070 (Trpv4)
SSDB
Motif
Pfam: Ion_trans Ank_2 Ank_3 Ank Ank_4 Ank_5
Other DBs
NCBI-GeneID: 100751070
NCBI-ProteinID: XP_035300227
LinkDB
Position
4
AA seq 871 aa
MADPGDSPRAVPGEMAEPPGDESGTSGGEAFPLSSLANLFEGEEGSSSLSPADASRPAGS
GDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRHHPSDN
KRWRRKVIEKQPQIPKAPAPQPPPILKVFNRPILFDIVSRGSTADLDGLLSFLLTHKKRL
TDEEFREPSTGKTCLPKALLNLNNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQT
SLHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHI
VNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCSRLFPDS
NLETVLNNDGLSPLMMAAKTGKIGVFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYD
LSSLDTCGEEVSVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYLC
AMVIFTLTAYYQPLEGTPPYPYRTTVDYLRLAGEIVTLFTGVLFFFTSIKDLFMKKCPGV
NSLFVDGSFQLLYFIYSVLVVVSAALYLAGIEAYLAVMVFALTLGWMNALYFTRGLKLTG
TYSIMIQKILFKDLFRFLLVYLLFMIGYASALVTLLNPCANMKVCDEDENNCTVPTYPAC
RDSETFSAFLLDLFKLTIGMGDLEMLSSAKYPVVFILLLVTYIILTFVLLLNMLIALMGE
TVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRV
DEVNWSHWNQNLGIINEDPGKSEIYQYYGFSHTMGRLRRDRWSSVVPRVVELNKNTSPDE
VVVPLDNLGNPNCDSHQQGYAPKWRTEDAPL
NT seq 2616 nt   +upstreamnt  +downstreamnt
atggcagatcctggtgacagcccccgtgcagtgcctggggagatggctgagccccctgga
gatgagagtggcacctctggtggggaggccttccccctctcttccttggccaatctgttt
gagggggaggaaggctcctcctcactttcaccggctgatgctagccgccctgctggctct
ggtgatgggcgtccgaacctgcgtatgaagttccaaggtgctttccgcaagggggttccc
aaccccattgacctgttggagtccaccctgtatgagtcctcagtagtgcctgggcccaaa
aaagcacccatggactcattgttcgactatggcacttaccgtcaccatcccagtgacaac
aagaggtggaggagaaaggtcatagagaaacagccacagatccctaaggctcctgcaccc
cagccaccccccatcctcaaagtcttcaacaggcccatcctctttgacatcgtgtcccgg
ggctccactgctgacctggacggactgctctctttcttgttgacccacaagaagcgcctg
actgacgaggagttccgggagccatccacagggaagacctgcctgcccaaggcgctgctg
aacctgaacaatggccgcaatgacaccatcccagtgttgctggacattgcggagcgcact
ggcaacatgcgcgagttcatcaactcgcccttcagagacatctactaccgaggccagacc
tccctgcacatcgctatagagcgccgctgcaaacactacgtggagctgctggtggcccag
ggagccgacgtgcacgcccaggcccgagggcgcttcttccagcccaaggatgagggcggc
tacttctactttggggagctgcccttgtccctggcagcctgcaccaaccagccgcacatc
gtgaactacctgacggagaaccctcacaagaaagcagacatgcggagacaggattcccga
ggcaacacggtgctgcacgcgctggtggccatcgccgacaacacccgcgagaacaccaag
tttgtcaccaagatgtatgacctgttgcttctcaagtgttcccgcctcttccctgacagc
aacctggagactgtgctcaacaatgatggcctttcacctctcatgatggctgccaagacg
ggcaagatcggggtcttccagcacattatccggcgggaggtgacagatgaagacacacgt
cacctgtctcgcaaattcaaggactgggcctatgggcctgtgtattcttcactctatgac
ctctcctccctggacacgtgtggggaggaggtgtcggtgctggagatcctggtgtataac
agcaagatcgagaatcgccatgagatgctggctgtggagcccatcaacgaactgctgagg
gacaaatggcgcaagtttggggccgtgtccttctacatcaacgtggtctcctatctgtgt
gccatggttatcttcaccctcacggcctactaccagccactggaaggcacgccaccctac
ccttaccgcaccacggtggactacctgaggctggctggtgagatcgtcacactcttcacg
ggagtcctgttcttctttaccagtatcaaagacttgttcatgaagaaatgccctggggtg
aattctctctttgttgatggctccttccagttgctctacttcatctactctgtgctggtg
gtcgtctctgcagcgctctacctggcggggatcgaggcctacctggctgtgatggtcttt
gctctgaccctgggttggatgaatgccctttacttcacccgagggctgaagctgactggc
acctacagcatcatgatccagaagatcctcttcaaagacctcttccgattcctgctggta
tacctgctcttcatgatcggctatgcttcagccctggtcaccctcctgaacccatgcgcc
aacatgaaggtgtgtgacgaggatgagaacaactgcacggtgcccacgtaccccgcctgc
cgcgacagcgagaccttcagcgccttcctgctggacctgttcaagctcaccatcggcatg
ggtgacctggagatgctgagcagcgccaagtaccccgtggtcttcatcctcctgctggtc
acttacatcatcctcacctttgtgcttctgcttaacatgctcatcgccctcatgggtgag
accgtgggccaggtgtccaaggagagcaagcatatctggaagctgcagtgggccaccacc
attctggacattgagcgttccttccccgtgttcctgaggaaggccttccggtcaggagag
atggtgactgtgggcaagagctcagacggcactccagaccgcaggtggtgctttagggtg
gacgaggtgaactggtctcactggaaccagaacttgggcatcattaacgaggacccaggc
aagagtgagatctaccagtactatggcttctcgcacaccatggggcgcctccgcagggat
cgctggtcctcagtggtgccccgtgtggtagagctgaacaagaacacaagcccagacgag
gtggtggtgcccctggataacctagggaaccccaactgtgacagccaccagcagggttat
gcccccaagtggaggacagaggatgctcccctctag

DBGET integrated database retrieval system