KEGG   Cricetulus griseus (Chinese hamster): 100751220Help
Entry
100751220         CDS       T02813                                 

Gene name
Ptgs2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00590  Arachidonic acid metabolism
cge01100  Metabolic pathways
cge04064  NF-kappa B signaling pathway
cge04370  VEGF signaling pathway
cge04625  C-type lectin receptor signaling pathway
cge04657  IL-17 signaling pathway
cge04668  TNF signaling pathway
cge04723  Retrograde endocannabinoid signaling
cge04726  Serotonergic synapse
cge04913  Ovarian steroidogenesis
cge04921  Oxytocin signaling pathway
cge04923  Regulation of lipolysis in adipocytes
cge05140  Leishmaniasis
cge05163  Human cytomegalovirus infection
cge05165  Human papillomavirus infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05200  Pathways in cancer
cge05204  Chemical carcinogenesis
cge05206  MicroRNAs in cancer
cge05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100751220 (Ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100751220 (Ptgs2)
   04064 NF-kappa B signaling pathway
    100751220 (Ptgs2)
   04668 TNF signaling pathway
    100751220 (Ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100751220 (Ptgs2)
   04657 IL-17 signaling pathway
    100751220 (Ptgs2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100751220 (Ptgs2)
   04913 Ovarian steroidogenesis
    100751220 (Ptgs2)
   04921 Oxytocin signaling pathway
    100751220 (Ptgs2)
  09156 Nervous system
   04726 Serotonergic synapse
    100751220 (Ptgs2)
   04723 Retrograde endocannabinoid signaling
    100751220 (Ptgs2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100751220 (Ptgs2)
   05206 MicroRNAs in cancer
    100751220 (Ptgs2)
   05204 Chemical carcinogenesis
    100751220 (Ptgs2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    100751220 (Ptgs2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    100751220 (Ptgs2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100751220 (Ptgs2)
   05165 Human papillomavirus infection
    100751220 (Ptgs2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    100751220 (Ptgs2)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100751220 (Ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 100751220
NCBI-ProteinID: XP_003496822
UniProt: G3GWV6
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLFRAVLLCAALALTHAANPCCSNPCQNRGECMSIGFDQYKCDCTRTGFYGENCTIPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSSIMRYVLTSRSHLIDSPPTYNVHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDQKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKY
QVIGGEVYPPTVKDTEAEMMYPPHTPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIEDQEYNFKQFLYNNSILIEHGLTQFVESFTRQIAGRV
AGGRNVPVAVKAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKAL
YSDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEV
GFKIINTASIQSLICNNVQGCPFTSFNVQDPQPTKAATINASASHSRLDDINPTVLIKGR
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcttccgagctgtgctgctctgtgccgctctggcgctcacccatgcagcaaatcct
tgctgttccaacccctgtcaaaaccgaggtgaatgtatgagcataggatttgaccagtat
aaatgtgattgtacccggacaggattctacggggaaaactgcactatacctgagtttctg
acgaggattaagttgctgctgaagcccaccccaaacacagtacactacatcctgacacac
ttcaagggagtctggaacattgtcaataacattcccttccttcgaagttcaatcatgaga
tatgtgttgacatccagatcacatttgattgacagtccaccaacttacaatgtgcactat
ggttataaaagctgggaagccttctccaatctctcctactataccagagcccttcctcct
gtggctgatgactgcccgactcccatgggtgtgaaaggaaataaggagcttcctgattca
aaagaagttctggaaaaagttcttctaaggagaaagttcatccctgatccccaaggctca
aatatgatgtttgcattctttgcccagcacttcactcatcagtttttcaagacagatcag
aaacgaggacctggcttcacccgaggactgggccatggggtggatttaaaccacatttac
ggtgaaactctagacaggcaacataaactgcgccttttcaaggatggaaaattgaaatat
caggtcattggtggagaggtgtatcctcctacagtcaaagacaccgaggcggagatgatg
taccctcctcacacccctgagcacctacggtttgctgtggggcaggaggtctttgggctg
gtgcctggtctgatgatgtatgctaccatctggcttcgggagcacaacagagtgtgtgat
gtgcttaaacaggagcatcctgagtgggacgatgagcagctattccagacgagcaggctc
attctgataggagagactatcaagattgtgatagaagactatgtgcagcacctgagtggc
taccacttcaaactcaagttcgacccggagctgcttttcaaccagcagttccagtatcag
aaccgcattgcagctgaattcaacacactgtaccactggcaccccttgctacccgacacc
tttcaaatcgaggaccaggagtacaactttaaacagttcctctacaacaactccatcctc
atcgagcatggactcacccagtttgttgaatcattcaccagacagattgctggccgggtt
gctgggggtaggaatgttccagttgcagtaaaagcagtggccaaggcctccattgaccag
agcagagagatgaaataccagtccctcaatgagtatcgcaaacgcttctccctgaagcct
tatacatcatttgaagaacttacaggagagaaggaaatggctgcagagttgaaagccctc
tacagtgacatcgatgccatggagctgtaccctgccctgctggtggaaaagcctcgtcca
gatgctatctttggggagaccatggtagaactcggagcaccattctccctgaaaggactt
atgggtaatcccatctgttctcctcaatactggaagccaagcacttttggaggagaagtg
ggttttaagatcatcaacactgcctcaattcagtctctcatctgtaataatgtgcagggc
tgccctttcacctccttcaatgtgcaagatccacagcctaccaaagcagccaccatcaat
gcaagtgcctcccattccagactagacgacatcaaccccacagtgctaatcaaagggcgt
tcaactgaactgtag

DBGET integrated database retrieval system