KEGG   Cricetulus griseus (Chinese hamster): 100751289
Entry
100751289         CDS       T02813                                 

Gene name
Wnt6
Definition
(RefSeq) protein Wnt-6 isoform X2
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100751289 (Wnt6)
   04390 Hippo signaling pathway
    100751289 (Wnt6)
   04150 mTOR signaling pathway
    100751289 (Wnt6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100751289 (Wnt6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100751289 (Wnt6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100751289 (Wnt6)
   05205 Proteoglycans in cancer
    100751289 (Wnt6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100751289 (Wnt6)
   05226 Gastric cancer
    100751289 (Wnt6)
   05217 Basal cell carcinoma
    100751289 (Wnt6)
   05224 Breast cancer
    100751289 (Wnt6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100751289 (Wnt6)
   05022 Pathways of neurodegeneration - multiple diseases
    100751289 (Wnt6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100751289 (Wnt6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100751289 (Wnt6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100751289 (Wnt6)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100751289 (Wnt6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100751289
NCBI-ProteinID: XP_027253051
LinkDB
Position
2
AA seq 366 aa
MMLPPVPSRFGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEP
EVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDIRETAFVFAITAAGASHA
VTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSTEASAAWEWGGCGDDVDFG
DEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQK
LPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRR
TGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRK
ELSLCL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgatgctgcctccggtgccctcccgcttcgggctgctgctgctgctgctcctatgccct
gcgcacgtcggtggactgtggtgggctgtgggtagccctctggtcatggatcctaccagc
atctgcaggaaggccaggcggctggcgggacggcaggctgagctgtgccaggcagagccg
gaagtggtggcagagctcgcccggggcgcaaggctgggggtccgagaatgtcagttccag
ttccgtttccgacgctggaactgctccagtcacagcaaggcctttgggcgcgtcttgcag
caggatattcgagagacagccttcgtgtttgcgattaccgcagccggcgccagccacgct
gtcacgcaggcctgttccatgggagagctcctgcagtgtggttgccaggcaccccgcggg
cgagcaccgccaaggccctctggcctcctgggcactcctggacctccagggccgacaggt
tcgacagaggccagcgcagcctgggagtggggaggctgtggagacgatgtggacttcggg
gatgagaagtcaagactctttatggatgcacagcacaagcgaggacgtggagacatccgc
gcactggtgcaactgcacaacaatgaggcaggcaggctggcggtgcggagtcacacgcgc
accgaatgtaaatgccacgggctttcgggttcgtgtgcgctgcgcacctgctggcagaag
ctgcctccattccgcgaggtgggcgcacggctgctggagcgcttccacggtgcctcgcgc
gtcatgggcaccaacgacggcaaagccctgctgcctgcagtccgcacgctcaagcctccc
ggacgagccgacctcctctacgctgccgactcgcccgacttctgcgcccccaaccggcgc
accggctcgccgggcacgcgcggccgcgcctgcaacagcagtgccccggacctcagcggc
tgcgacctgttgtgctgcggtcgcggacaccgccaggagagcgtacagctcgaggagaac
tgcctgtgccgcttccactggtgctgcgtggtgcagtgccaccgctgccgcgtgcgcaag
gagctcagcctgtgcctctga

KEGG   Cricetulus griseus (Chinese hamster): 100752722
Entry
100752722         CDS       T02813                                 

Gene name
Wnt2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100752722 (Wnt2)
   04390 Hippo signaling pathway
    100752722 (Wnt2)
   04150 mTOR signaling pathway
    100752722 (Wnt2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100752722 (Wnt2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100752722 (Wnt2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100752722 (Wnt2)
   05205 Proteoglycans in cancer
    100752722 (Wnt2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100752722 (Wnt2)
   05226 Gastric cancer
    100752722 (Wnt2)
   05217 Basal cell carcinoma
    100752722 (Wnt2)
   05224 Breast cancer
    100752722 (Wnt2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100752722 (Wnt2)
   05022 Pathways of neurodegeneration - multiple diseases
    100752722 (Wnt2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100752722 (Wnt2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100752722 (Wnt2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100752722 (Wnt2)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100752722 (Wnt2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100752722
NCBI-ProteinID: XP_027245752
LinkDB
Position
1
AA seq 360 aa
MNVPLGGIWLWLPLLLTWLAPEVSSSWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGELKSCSCDPKKKGSAKDSKGTFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPKSADWTTPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgtccctctcggtggaatctggctctggctccctctgctcttgacctggctcgcc
cctgaggtcagctcttcatggtggtacatgagagctacaggtggctcctccagagtgatg
tgtgacaatgtgccaggcctggtgagccgccagcgtcagctgtgtcaccgacatccagat
gtgatgcgtgccattggcctgggtgtggctgagtggacagcagagtgccagcaccagttc
cgccagcaccgctggaactgtaacaccctggacagagatcacagcctctttggccgggtc
ctcctccgaagtagtcgggaatctgcctttgtttacgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaattaaagtcctgctcctgtgacccaaag
aagaaaggaagtgccaaggacagcaaaggcacctttgactggggtggctgcagtgacaac
attgactatgggatcaagtttgcccgtgcatttgtagatgccaaggaaaggaaagggaag
gatgccagagccctgatgaatcttcacaacaacagagctggaaggaaggctgtcaagcgg
ttcttgaaacaagaatgcaagtgtcatggtgtgagtggctcctgtactctgaggacctgc
tggctggccatggctgacttcaggaaaacaggcgactatctttggaggaagtacaacggg
gcaatccaggtcgtcatgaaccaggatggcaccggcttcactgtggccaataagagattt
aagaagccaacgaaaaatgacctcgtgtattttgagaattctccagactactgtatcagg
gaccgagaggcaggctctctgggtacagcaggccgtgtgtgcaacttgacttcccgaggc
atggacagctgtgaagtcatgtgttgtgggagaggctatgacacatcccatgtcacccgg
atgaccaaatgtgagtgtaaattccactggtgctgtgctgtgcgctgtcaggactgcctg
gaggccctggatgtgcacacctgcaaggcccccaagagtgccgactggactacacctaca
tga

KEGG   Cricetulus griseus (Chinese hamster): 100752907
Entry
100752907         CDS       T02813                                 

Gene name
Wnt8a
Definition
(RefSeq) protein Wnt-8a isoform X2
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100752907 (Wnt8a)
   04390 Hippo signaling pathway
    100752907 (Wnt8a)
   04150 mTOR signaling pathway
    100752907 (Wnt8a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100752907 (Wnt8a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100752907 (Wnt8a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100752907 (Wnt8a)
   05205 Proteoglycans in cancer
    100752907 (Wnt8a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100752907 (Wnt8a)
   05226 Gastric cancer
    100752907 (Wnt8a)
   05217 Basal cell carcinoma
    100752907 (Wnt8a)
   05224 Breast cancer
    100752907 (Wnt8a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100752907 (Wnt8a)
   05022 Pathways of neurodegeneration - multiple diseases
    100752907 (Wnt8a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100752907 (Wnt8a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100752907 (Wnt8a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100752907 (Wnt8a)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100752907 (Wnt8a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100752907
NCBI-ProteinID: XP_027256328
UniProt: G3HF01
LinkDB
Position
2
AA seq 357 aa
MGRVIGHLFMLWVAAGMCYAPFGASAWSVNNFLVTGPKAYLTYTTSVALGTQTGMEECKF
QFAWERWNCPEHAFQFSTHNRLRGATRESSFIHAIRSAGVVYIITKNCSMGDFENCGCDG
SKNGKAGGHGWIWGGCSDNVEFGEQISRVFVDSLERGKDARALVNLHNSRAGRLAVRASM
KRTCKCHGISGSCSIQTCWLQLADFREMGDYLKAKYDRAQKIELDKRQLSAGNRAEGRWA
PTEAFLPSAEAELIFLEDSPDYCTRNASLGIHGTEGRECLQNARGASRWEQRSCGRLCTE
CGLQVEERRTQVMSSCDCSFKWCCTVKCGQCRRVVNRYYCTRPEGSVRPRGRGKGSA
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgggcagggtcatagggcacttgtttatgctgtgggtggctgcaggcatgtgttatgcc
cccttcggtgcctctgcctggtcagtgaacaatttcctggtaacaggtcccaaggcctat
ctgacctacaccaccagtgtggccttgggcactcagactggcatggaagaatgtaagttc
cagtttgcttgggagcggtggaactgccctgaacatgctttccagttctccactcacaac
aggctgagaggggccacaagggagtcatccttcattcacgccatccgctctgctggagtt
gtgtatatcatcaccaagaactgcagcatgggtgactttgaaaactgtggttgcgatggg
tcaaaaaatggaaaagcaggtggccatggctggatctggggaggctgcagcgacaatgtg
gaatttggggaacagatctccagagtcttcgtggacagcctggagagagggaaggatgcc
agggccctggtgaatcttcataacagcagggcaggcaggctggcagtgagggcctccatg
aaaaggacatgcaaatgtcatggcatctcaggaagctgtagcatccagacgtgctggctg
cagctggccgacttccgggagatgggagactacctaaaggccaagtacgaccgcgcacag
aaaattgagctagataagcgccagctaagtgctggcaacagagccgagggccgctgggct
cccacagaggcctttcttcccagcgcagaggctgagctgatcttcttggaggactcaccc
gactactgcacccgcaatgccagcctgggcatccacggcacagagggacgtgagtgcctg
cagaacgcgcgtggtgcttccaggtgggagcagcgcagctgtgggcgcttgtgcaccgag
tgtgggctgcaggtggaagagaggagaacacaggtcatgagcagctgtgactgcagcttt
aagtggtgctgcactgtcaagtgtggccagtgcaggcgtgttgtgaacaggtactactgc
acacgccccgaggggagtgtccggcctcggggcaggggcaagggcagtgcttga

KEGG   Cricetulus griseus (Chinese hamster): 100753017
Entry
100753017         CDS       T02813                                 

Gene name
Wnt5b
Definition
(RefSeq) protein Wnt-5b isoform X2
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100753017 (Wnt5b)
   04390 Hippo signaling pathway
    100753017 (Wnt5b)
   04150 mTOR signaling pathway
    100753017 (Wnt5b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100753017 (Wnt5b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100753017 (Wnt5b)
  09158 Development and regeneration
   04360 Axon guidance
    100753017 (Wnt5b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100753017 (Wnt5b)
   05205 Proteoglycans in cancer
    100753017 (Wnt5b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100753017 (Wnt5b)
   05226 Gastric cancer
    100753017 (Wnt5b)
   05217 Basal cell carcinoma
    100753017 (Wnt5b)
   05224 Breast cancer
    100753017 (Wnt5b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100753017 (Wnt5b)
   05022 Pathways of neurodegeneration - multiple diseases
    100753017 (Wnt5b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100753017 (Wnt5b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100753017 (Wnt5b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100753017 (Wnt5b)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100753017 (Wnt5b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100753017
NCBI-ProteinID: XP_027285081
UniProt: G3H870
LinkDB
Position
8
AA seq 371 aa
MLVPGHWDGLRFTMPSLMLFTAALLSSWAQLLTDASSWWSLALNPVQRPEMFIIGAQPVC
SQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVMQ
IGSRETAFTYAVSAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYG
YRFAKEFVDAREREKNFVKGSEEQGRALMNLQNNEAGRRAVYKMADVACKCHGVSGSCSL
KTCWLQLAEFRKVGDRLKEKYDSAAAVRITRQGKLELANSRFNQPTPEDLVYVDPSPDYC
LRNETTGSLGTQGRLCNKTSEGTDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKK
CTEIVDQYVCK
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgttggttccagggcactgggatgggctgaggttcaccatgcccagcctgatgttgttc
acagcagctctgctctccagctgggcccagctactgactgatgccagctcctggtggtcg
ctagctctgaacccggtgcagagacctgagatgttcatcattggtgctcagcctgtgtgc
agccagcttcctgggctttccccaggccagagaaagctgtgtcagttgtatcaggagcac
atgtcctacatcggggagggagccaagacgggcatcagggagtgccagcaccagttccgg
cagaggcgctggaactgtagtactgtggacaacacgtctgtcttcggcagagtcatgcag
ataggtagccgggagactgccttcacctatgcagtgagtgctgccggtgtggtgaatgcc
atcagccgtgcttgccgagagggtgagctgtccacctgtggctgcagccggactgccagg
cccaaggacctgccacgagactggctgtggggtggctgtggggacaatgtggagtatggc
taccgctttgccaaagagtttgtagatgcccgagagcgtgagaagaactttgtcaaggga
tcagaggagcagggccgagccctcatgaacctacagaacaacgaggctggccgccgggct
gtgtataagatggctgatgtcgcctgcaaatgtcacggagtctcagggtcctgcagcctc
aagacctgctggctccagctggctgagttccgcaaggtaggggaccggttgaaagagaag
tatgacagcgctgccgccgtgcgcatcacccgccagggcaagctggagctggctaacagc
cgcttcaaccagcccacgccagaggacctggtctacgtggaccccagccctgactactgc
ctgcgcaacgagaccacaggctcactgggcacccagggccgcctctgcaacaagacctca
gagggcacggatggctgtgagctcatgtgctgtggccgcggctatgaccgcttcaagagc
gtccaggtggagcgttgccactgcaggttccactggtgttgctttgtcaggtgcaaaaaa
tgcaccgagattgtggaccagtatgtctgtaaatga

KEGG   Cricetulus griseus (Chinese hamster): 100753089
Entry
100753089         CDS       T02813                                 

Gene name
Wnt5a
Definition
(RefSeq) protein Wnt-5a
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100753089 (Wnt5a)
   04390 Hippo signaling pathway
    100753089 (Wnt5a)
   04150 mTOR signaling pathway
    100753089 (Wnt5a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100753089 (Wnt5a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100753089 (Wnt5a)
  09158 Development and regeneration
   04360 Axon guidance
    100753089 (Wnt5a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100753089 (Wnt5a)
   05205 Proteoglycans in cancer
    100753089 (Wnt5a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100753089 (Wnt5a)
   05226 Gastric cancer
    100753089 (Wnt5a)
   05217 Basal cell carcinoma
    100753089 (Wnt5a)
   05224 Breast cancer
    100753089 (Wnt5a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100753089 (Wnt5a)
   05022 Pathways of neurodegeneration - multiple diseases
    100753089 (Wnt5a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100753089 (Wnt5a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100753089 (Wnt5a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100753089 (Wnt5a)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100753089 (Wnt5a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100753089
NCBI-ProteinID: XP_035309360
UniProt: A0A3L7GV45
LinkDB
Position
1
AA seq 360 aa
MSSKFFLMALAMFFSFAQVVIEANSWWSLGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQK
KLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYA
VSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDAR
ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFR
KVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGT
QGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtcttccaagttcttcctaatggctttggccatgtttttctccttcgcccaggttgta
atagaagctaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaggta
tatatcataggtgcacagcctctctgtagtcaactggcagggctttctcaaggacagaag
aaactctgccacttgtatcaggaccacatgcagtacattggagaaggtgcgaagacaggc
atcaaagaatgtcaataccagtttcggcatcggaggtggaactgcagcacagttgacaac
acctctgtctttggcagggtgatgcaaataggcagcagagagacagccttcacatacgcg
gtgagcgcagctggggtggtgaatgccatgagccgtgcatgccgcgagggcgagctatcc
acctgtggctgcagcagagctgcacgccctaaggacctgcctcgggactggctgtggggc
ggctgtggagacaacatcgactatggctaccgctttgccaaggaattcgtggatgcacga
gaacgggaacgaatccatgccaagggctcctatgagagcgcacgcatccttatgaacctg
cacaataatgaagcaggccgtaggacagtatacaacttggcagatgtagcctgcaagtgc
catggagtgtctggctcgtgtagcctcaagacatgctggctgcagctggcggacttccga
aaggtgggcgatgccctcaaggagaaatatgacagcgcagcagccatgaggctgaactcc
cggggcaagctggtacaggtcaacagccgcttcaactccccaaccacgcaggacctggtc
tatatcgacccaagcccggattactgtgtgcgcaatgagagcacaggctcactgggcaca
cagggccgcctttgcaacaagacctcagagggcatggatggctgcgagctcatgtgctgt
ggtcgtggctatgaccagtttaagacggtgcagactgaacgctgtcattgcaagtttcac
tggtgctgctatgtcaagtgcaagaagtgcacggagattgtggatcagttcgtgtgcaaa
tag

KEGG   Cricetulus griseus (Chinese hamster): 100755799
Entry
100755799         CDS       T02813                                 

Gene name
Wnt7b
Definition
(RefSeq) protein Wnt-7b isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100755799 (Wnt7b)
   04390 Hippo signaling pathway
    100755799 (Wnt7b)
   04150 mTOR signaling pathway
    100755799 (Wnt7b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100755799 (Wnt7b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100755799 (Wnt7b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100755799 (Wnt7b)
   05205 Proteoglycans in cancer
    100755799 (Wnt7b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100755799 (Wnt7b)
   05226 Gastric cancer
    100755799 (Wnt7b)
   05217 Basal cell carcinoma
    100755799 (Wnt7b)
   05224 Breast cancer
    100755799 (Wnt7b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100755799 (Wnt7b)
   05022 Pathways of neurodegeneration - multiple diseases
    100755799 (Wnt7b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100755799 (Wnt7b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100755799 (Wnt7b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100755799 (Wnt7b)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100755799 (Wnt7b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100755799
NCBI-ProteinID: XP_027251981
UniProt: G3ICH8
LinkDB
Position
2
AA seq 353 aa
MLLLSPRSALVSVYCPQIFLLLSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRP
DAIIVIGEGAQMGINECQHQFRFGRWNCSALGEKTVFGQELRVGSREAAFTYAITAAGVA
HAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIKKNA
RRLMNLHNNEAGRKVLEDRMKLECKCHGVSGSCTTKTCWTTLPKFREVGHLLKEKYNAAV
QVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRLCNR
TSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgctcctcctgtcgccgcgcagcgcgctggtctccgtctattgcccgcagatctttctc
cttctgtccagcggcagctacctagcactgtcgtccgtggtggccctaggagccaacatc
atctgcaacaagattcctggcctggcccctcggcagcgcgccatctgccagagccgcccc
gatgccatcattgtgatcggggagggggctcagatgggcatcaatgagtgccaacaccag
ttccgattcggccgctggaactgctccgccctgggcgagaagaccgtcttcgggcaagag
ctccgagtagggagtcgtgaggctgccttcacatacgccatcaccgcggcaggcgtggca
catgctgtcactgctgcctgcagccagggtaacctgagcaactgtggctgtgaccgtgag
aagcaaggctactacaaccaggctgaaggctggaagtggggaggctgctcggctgatgtg
cgctatggcattgacttttcccgacgatttgtggatgctcgtgagatcaaaaagaacgcc
aggcgcctcatgaacctccacaacaatgaggcaggcagaaaggttctggaggaccgcatg
aagcttgaatgtaagtgtcacggtgtgtcgggctcgtgtaccaccaagacctgctggacc
acgctgcccaagttccgtgaggtgggccacctgctcaaggagaaatacaacgcagccgtg
caggtggaggtggtacgcgccagccgtctgcgccagcccaccttcctgcgcatcaagcag
ctgcgcagctaccagaagcccatggagacggacctggtgtacattgagaagtcgcccaac
tactgcgaggaggacgcagccacgggcagcgtgggcacgcagggccgcctgtgcaaccgc
acctctccaggcgccgacggctgcgacaccatgtgctgcggccgcggctacaacacgcac
cagtacaccaaggtgtggcagtgcaactgcaaattccactggtgttgcttcgtcaagtgc
aacacatgcagcgagcgcaccgaggtcttcacctgcaagtga

KEGG   Cricetulus griseus (Chinese hamster): 100761413
Entry
100761413         CDS       T02813                                 

Gene name
Wnt2b
Definition
(RefSeq) protein Wnt-2b
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100761413 (Wnt2b)
   04390 Hippo signaling pathway
    100761413 (Wnt2b)
   04150 mTOR signaling pathway
    100761413 (Wnt2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100761413 (Wnt2b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100761413 (Wnt2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100761413 (Wnt2b)
   05205 Proteoglycans in cancer
    100761413 (Wnt2b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100761413 (Wnt2b)
   05226 Gastric cancer
    100761413 (Wnt2b)
   05217 Basal cell carcinoma
    100761413 (Wnt2b)
   05224 Breast cancer
    100761413 (Wnt2b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100761413 (Wnt2b)
   05022 Pathways of neurodegeneration - multiple diseases
    100761413 (Wnt2b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100761413 (Wnt2b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100761413 (Wnt2b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100761413 (Wnt2b)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100761413 (Wnt2b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100761413
NCBI-ProteinID: XP_035307767
LinkDB
Position
1
AA seq 299 aa
MRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVH
AITRACSQGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKD
ARALMNLHNNRCGRTAVRRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGA
VQVTATQDGANFTAARQGYRHATRTDLVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGT
DGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 900 nt   +upstreamnt  +downstreamnt
atgcgctcagtgggtgaaggtgcccgagaatggatccgagagtgtcagcaccagttccgc
catcaccgctggaactgcaccacactggaccgggaccatactgtctttggccgtgtcatg
cttagaagtagccgggaagcagcatttgtatatgccatctcatcagctggagtggtccat
gctatcactcgggcctgcagccagggtgaattgagcgtgtgcagctgtgacccatatacc
cgtggtcggcaccatgaccaacgaggggactttgattggggtggctgtagtgacaatatc
cactatggtgtccgctttgccaaggcttttgtggatgccaaagagaagaggcttaaggat
gcccgggccctcatgaacttacataacaaccgctgtggtcgcacggctgtgcggcgattt
ctgaagctggaatgtaagtgtcatggtgtgagtggctcctgtactctacgcacctgctgg
agagcactctcagacttccgccgcactggtgactacctgaggcggaggtatgatggggct
gtgcaggtgactgccacccaggatggtgccaacttcacagcagcccgccaaggctatcgc
catgccacccggactgatcttgtctactttgacaactcccctgactactgtgtcttggac
aaggctgcaggttccctaggtactgcaggccgggtctgcagcaagacatctaaaggaaca
gatggttgtgaaatcatgtgttgtggtcgagggtacgacacaactcgagtcacccgtgtc
acccaatgtgagtgcaaattccactggtgctgtgctgtgcggtgcaaagagtgcagaaac
actgtggatgtccatacttgcaaggcccccaagaaggcagagtggctggaccagacctga

KEGG   Cricetulus griseus (Chinese hamster): 100764115
Entry
100764115         CDS       T02813                                 

Gene name
Wnt16
Definition
(RefSeq) protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05202  Transcriptional misregulation in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100764115 (Wnt16)
   04390 Hippo signaling pathway
    100764115 (Wnt16)
   04150 mTOR signaling pathway
    100764115 (Wnt16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100764115 (Wnt16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100764115 (Wnt16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100764115 (Wnt16)
   05202 Transcriptional misregulation in cancer
    100764115 (Wnt16)
   05205 Proteoglycans in cancer
    100764115 (Wnt16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100764115 (Wnt16)
   05226 Gastric cancer
    100764115 (Wnt16)
   05217 Basal cell carcinoma
    100764115 (Wnt16)
   05224 Breast cancer
    100764115 (Wnt16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100764115 (Wnt16)
   05022 Pathways of neurodegeneration - multiple diseases
    100764115 (Wnt16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100764115 (Wnt16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100764115 (Wnt16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100764115 (Wnt16)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100764115 (Wnt16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100764115
NCBI-ProteinID: XP_027245540
UniProt: G3IDN6
LinkDB
Position
1
AA seq 364 aa
MDRAALLALPSLCALWAAVLSLFPCGTQGNWMWLGIASFGVPEKLGCDGLPLNSRQKELC
KRKPYLLPSIHEGARLGIQECKSQFRHERWNCMVATATSVPLATSPLFGYELSSGTKETA
FIYAIMAAGLVHSVTRSCSAGNMTECSCDTALQNGGSPSEGWHWGGCSDDVQYGMWFSRK
FLDFPIRNTTAKESRVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSS
FEKIGHFLKDKYENSIQISDKTKRKMRRREKDQRQTPIHKDDLLYVHKSPNYCVENKKLG
IPGTQGRECNRTSGGADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDV
HTCK
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggacagagcagcgctcctggccctgcccagcttgtgtgcgctgtgggcagcggtgctc
tccctgttcccctgcggaacccagggcaactggatgtggctgggcattgcctcctttgga
gtaccggagaagctgggctgtgacggcttgccgctgaacagccgccagaaggagctgtgc
aagaggaaaccgtacctgctgcccagcatccacgagggcgcccgattgggcattcaggag
tgcaagagccagttccgacatgagagatggaactgtatggtcgccaccgccacctccgtc
ccgctcgccaccagtcccctctttggctatgagctgagtagtggcaccaaggagacagct
ttcatttatgccatcatggctgcaggcctggtgcattctgtaaccaggtcgtgcagtgca
ggaaatatgaccgagtgttcctgcgacaccgccttgcaaaatggtggctcaccaagtgaa
ggctggcattgggggggatgctctgatgacgtccagtacggcatgtggttcagcagaaag
tttctagatttccccatcagaaacaccacagcaaaagaaagcagagtactgctagccatg
aacttacacaacaatgaagcgggaaggcaggctgtcgccaagttgatgtctgtggattgc
cgctgccatggagtttccggctcctgtgctgtgaaaacctgctggaaaactatgtcgtct
tttgaaaagattgggcattttttaaaggataaatatgaaaacagcatccagatttcagac
aaaaccaagaggaaaatgcgcaggagagaaaaagatcagagacagacacccattcacaag
gatgacctgctgtacgttcataagtctcccaactactgtgtggagaacaagaaactgggt
attcctgggacacagggcagagagtgcaaccgtacctcaggaggtgctgatggctgcaac
ctcctctgctgtggccgaggctacaacacccatgtggtcaggcacgtggagaggtgtgag
tgtaagtttatctggtgctgctatgtccgctgcaggaggtgtgaaagcatgaccgacgtg
cacacttgtaagtaa

KEGG   Cricetulus griseus (Chinese hamster): 100764164
Entry
100764164         CDS       T02813                                 

Gene name
Wnt3a
Definition
(RefSeq) protein Wnt-3a isoform X2
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100764164 (Wnt3a)
   04390 Hippo signaling pathway
    100764164 (Wnt3a)
   04150 mTOR signaling pathway
    100764164 (Wnt3a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100764164 (Wnt3a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100764164 (Wnt3a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100764164 (Wnt3a)
   05206 MicroRNAs in cancer
    100764164 (Wnt3a)
   05205 Proteoglycans in cancer
    100764164 (Wnt3a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100764164 (Wnt3a)
   05226 Gastric cancer
    100764164 (Wnt3a)
   05217 Basal cell carcinoma
    100764164 (Wnt3a)
   05224 Breast cancer
    100764164 (Wnt3a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100764164 (Wnt3a)
   05022 Pathways of neurodegeneration - multiple diseases
    100764164 (Wnt3a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100764164 (Wnt3a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100764164 (Wnt3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100764164 (Wnt3a)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100764164 (Wnt3a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100764164
NCBI-ProteinID: XP_027282004
LinkDB
Position
7
AA seq 353 aa
MAPLGYLLLVLCSLKQALGSYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNY
VEIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAG
VAFAVTRSCAEGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDA
RSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTVGDFLKDKYDSAS
EMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNV
SSHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTCK
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggctcctctcggatacctcttactagtgctctgcagcctgaagcaggcgctgggcagc
tacccgatctggtggtctttagctgtgggaccccagtactcctccctgagcactcagccc
atcctctgtgccagcatcccaggcctggtgcccaagcagctgcgcttctgcaggaattat
gtggagatcatgcccagcgtggctgaaggtgtcaaggctggcatccaggagtgccagcac
cagttccgaggccggcgttggaactgtactactgtcagcaacagcctggcaatctttggc
cctgttctggacaaagccactcgggagtcagcctttgtccatgccattgcctctgctgga
gtggcctttgcagtgacccgctcatgtgcagagggctcagcagccatctgtgggtgcagt
agtcgcctccagggctccccaggtgagggctggaagtggggcggttgcagcgaggacatt
gaatttggtggaatggtgtctcgggagtttgctgatgccagagagaaccggccagatgcc
cgctctgccatgaaccgtcacaacaatgaggctgggcgccaggccatcgccagtcacatg
cacctcaaatgtaaatgccacggactatcgggcagctgcgaagtgaagacctgctggtgg
tcgcagcccgacttccgcactgttggggatttcctcaaagacaagtatgacagcgcctcc
gagatggtggtggagaaacaccgtgagtctcgtggctgggtggagactctgcgaccacgt
tacacgtacttcaaggtgcccacagagcgcgacctggtctactatgaggcctcgcccaac
ttctgtgaaccaaaccctgaaacaggctcctttgggacgcgcgaccgcacctgcaacgtg
agctctcacggcatagacgggtgtgacctactgtgctgcgggcgcggccataacgcgcgc
actgagcgaagaagggagaagtgccactgtgttttccactggtgctgctacgtcagttgc
caggagtgcacacgcgtctatgacgtgcatacctgcaagtag

KEGG   Cricetulus griseus (Chinese hamster): 100764466
Entry
100764466         CDS       T02813                                 

Gene name
Wnt9a
Definition
(RefSeq) protein Wnt-9a isoform X2
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100764466 (Wnt9a)
   04390 Hippo signaling pathway
    100764466 (Wnt9a)
   04150 mTOR signaling pathway
    100764466 (Wnt9a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100764466 (Wnt9a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100764466 (Wnt9a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100764466 (Wnt9a)
   05205 Proteoglycans in cancer
    100764466 (Wnt9a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100764466 (Wnt9a)
   05226 Gastric cancer
    100764466 (Wnt9a)
   05217 Basal cell carcinoma
    100764466 (Wnt9a)
   05224 Breast cancer
    100764466 (Wnt9a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100764466 (Wnt9a)
   05022 Pathways of neurodegeneration - multiple diseases
    100764466 (Wnt9a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100764466 (Wnt9a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100764466 (Wnt9a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100764466 (Wnt9a)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100764466 (Wnt9a)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 100764466
NCBI-ProteinID: XP_027283147
LinkDB
Position
7
AA seq 365 aa
MLDGSLLARWLAAAFGLTLLLAALRPSAAYFGLTGSEPLTILPLTLETEAAAQAHYKACD
RLKLERKQRRMCRRDPGVAETLVEAVSMSALECQYQFRFERWNCTLEGRYRASLLKRGFK
ETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVK
EFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVG
KHLKHKYETALKVGSTTNEATGEAGAISPPRGRASGSGGGDPLPRTPELVHLDDSPSFCL
AGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEV
YTCKG
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctggatgggtcccttctggcgcgctggctggccgcggcctttgggctgacgctgctg
ctcgccgcgctgcgcccttcggccgcctacttcgggctaacaggcagtgaacccctgact
atcctccctctgactctggagactgaggctgcagcccaagcacactacaaggcctgtgac
aggctgaaactggaacgcaaacagcgtcgcatgtgccgcagggacccaggtgtagccgag
acgctggtggaggctgtgagcatgagtgcactggagtgccagtaccagttccgctttgag
cgttggaactgcaccctggagggccgctaccgagctagcctgctgaagcgaggcttcaag
gagactgccttcctctatgccatctcttctgcgggcctgacccatgcactggccaaggcc
tgcagtgcagggcgcatggagcgctgtacctgtgatgaggcccctgacctggaaaaccgt
gaggcttggcaatggggtggctgtggagacaacctcaagtacagcagcaagtttgtcaag
gagttcctgggccggcggtctagcaaggatctgcgagcccgagtggacttccacaacaac
ctcgtgggtgtgaaggtgataaaggctggagtagagaccacctgcaaatgccatggcgta
tctggctcctgcacggtgcggacctgttggcggcagctcgcacccttccacgaggtgggc
aagcacctgaaacacaaatatgagacagcgctcaaggtgggcagcactaccaatgaagcc
accggtgaagctggtgccatctccccaccacgaggcagggcctctgggtcaggaggtggt
gacccactgccccgaacaccagagctggtgcacctggatgactctcccagcttttgtctg
gctggccgcttttctcctggcactgcaggccgcaggtgccaccgtgagaagaactgtgag
agtatctgttgtggccgtggccacaacacacagagccgtgtggtgacaaggccctgccaa
tgccaggtgcgctggtgctgctatgtggagtgcaggcagtgtacacagcgagaggaggtc
tacacctgcaagggctga

KEGG   Cricetulus griseus (Chinese hamster): 100766046
Entry
100766046         CDS       T02813                                 

Gene name
Wnt1
Definition
(RefSeq) proto-oncogene Wnt-1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100766046 (Wnt1)
   04390 Hippo signaling pathway
    100766046 (Wnt1)
   04150 mTOR signaling pathway
    100766046 (Wnt1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100766046 (Wnt1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100766046 (Wnt1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100766046 (Wnt1)
   05205 Proteoglycans in cancer
    100766046 (Wnt1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100766046 (Wnt1)
   05226 Gastric cancer
    100766046 (Wnt1)
   05217 Basal cell carcinoma
    100766046 (Wnt1)
   05224 Breast cancer
    100766046 (Wnt1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100766046 (Wnt1)
   05022 Pathways of neurodegeneration - multiple diseases
    100766046 (Wnt1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100766046 (Wnt1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100766046 (Wnt1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100766046 (Wnt1)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100766046 (Wnt1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100766046
NCBI-ProteinID: XP_027251822
UniProt: G3I6J2
LinkDB
Position
2
AA seq 370 aa
MGLWVLLPSWVSATLLLALTALPAALAANSSGRWWGIVNIASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGNNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggctgtgggtgctgctgcccagctgggtttctgctacgttgctactggcactgact
gccctgcccgcagccctggccgccaacagcagtggccgatggtggggcatcgtgaacata
gcctcctccacaaacctgctaacggattccaagagtctacagctggtactagagcccagt
ctgcagctactgagccgcaagcagcggcgactgatccgacagaacccgggaatcctgcac
agcgtgagtggagggctgcagagcgcagtgcgagagtgcaagtggcaattccgaaaccgc
cgctggaactgccctaccgctcccgggccccacctcttcggcaagatcgtcaaccgaggc
tgccgggaaacagcatttatcttcgcaatcacctccgctggggtcacacattcggtggca
cgttcctgctccgaaggttccattgagtcttgcacctgtgactaccggcggcgcggccct
gggggacccgactggcactggggaggctgcagcgacaacatcgatttcggccgcctcttc
ggccgagaattcgtggactctggggaaaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcagggcgcacgaccgtgttctctgagatgcgccaggagtgcaaatgc
cacggaatgtccggctcctgcacagtgcgcacgtgttggatgcgactgcccacgctgcgc
gctgtgggcgacgtgctgcgcgaccgcttcgacggcgcctcccgcgtcctttacggcaac
cggggcaacaaccgcgcttcgcgggcggagctgctgcgcctagagccggaagaccccgcg
cacaagccaccctcccctcacgaccttgtctacttcgagaaatcgcccaacttctgcaca
tacagcggacgcctgggaacagccggcacagccgggcgtgcttgcaacagctcttctccc
gcgctggacggctgtgagctgctgtgctgtggccggggccaccgtacgcgcacgcagcgc
gtcacggagcgttgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

KEGG   Cricetulus griseus (Chinese hamster): 100766088
Entry
100766088         CDS       T02813                                 

Gene name
Wnt9b
Definition
(RefSeq) protein Wnt-9b isoform X2
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100766088 (Wnt9b)
   04390 Hippo signaling pathway
    100766088 (Wnt9b)
   04150 mTOR signaling pathway
    100766088 (Wnt9b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100766088 (Wnt9b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100766088 (Wnt9b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100766088 (Wnt9b)
   05205 Proteoglycans in cancer
    100766088 (Wnt9b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100766088 (Wnt9b)
   05226 Gastric cancer
    100766088 (Wnt9b)
   05217 Basal cell carcinoma
    100766088 (Wnt9b)
   05224 Breast cancer
    100766088 (Wnt9b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100766088 (Wnt9b)
   05022 Pathways of neurodegeneration - multiple diseases
    100766088 (Wnt9b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100766088 (Wnt9b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100766088 (Wnt9b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100766088 (Wnt9b)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100766088 (Wnt9b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100766088
NCBI-ProteinID: XP_035304049
UniProt: G3IP03
LinkDB
Position
7
AA seq 460 aa
MGAQDTQDESTKGALTMQTALQRKPLSGASMGLCRAEAKAPGISGFPDPSSSLYLAWALI
CSTPGWAHLIDLESTGAPGTLPGPPPSNEASYFSGRQRGYGIQPNVLAEAGNSNGRDPKL
TISLLILSSLTGRDVLTPFPGLGTAAAPAQAGAHLKQCDLLKLSRRQKQLCRREPGLAET
LRDAAHLGLLECQFQFRQERWNCSLEGRTGLLQRGFKETAFLYAVSAAALTHALARACSA
GRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGPKRGSKDLRARADAHNTHV
GIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDTAVKVSSATNEALG
RLELWAPAKPGGPAKGLAPRPGDLVYMEDSPSFCRPSKYSPGTAGRVCSRDASCSSLCCG
RGYDTQSRVVAFSCHCQVQWCCYVECQQCAQQELVYTCKR
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgggggcccaagatactcaagatgaaagcacaaagggagcactgaccatgcaaacggcc
ctgcagcggaagccgttatcaggagcatctatggggctctgcagggctgaggccaaggcc
ccaggcatctcaggctttcctgatcccagtagcagcctgtacttggcatgggccctgata
tgctccacgccaggctgggcacacctgatagacttggaatctacaggggcacctgggacc
ttgccaggacccccaccctccaatgaggcttcctatttctcaggcagacagagaggctat
ggcatccagccaaatgtcctggctgaggcaggcaactccaacggcagggaccccaagctc
accatctcccttctcatcctctccagcttgacagggcgtgatgtcctgacgcctttccca
ggcctgggcacagcggcagccccggcacaggctggtgcccacctgaagcagtgtgacctg
ctgaagctgtctcggcggcagaagcagctctgcaggagggagcctggcctggctgagacc
ctgagggacgctgcacacctggggctgctggaatgtcagttccagttcaggcaggagcgc
tggaactgcagcctggaggggaggaccggcctgctccagagaggcttcaaggagacagcc
ttcctgtatgctgtgtctgcagctgccctcacgcatgcgctggcccgggcctgtagtgca
ggacgcatggagcgttgcacctgcgatgactccccgggcctggagagcaggcaggcctgg
caatggggtgtatgtggtgacaacctgaagtacagcaccaagttcctaagcaacttcctg
gggcccaagagaggaagcaaggacctgcgagcccgagctgatgcccacaacacccacgtg
ggcatcaaggctgtgaagagtggcctgagaacaacctgtaagtgccatggcgtgtcaggc
tcctgtgctgtgcgtacctgttggaagcagctctccccatttcgggagactggccaggtg
ctgaagctacgctatgacacggctgtcaaggtatccagtgccaccaatgaggctttgggc
cgtctggagctatgggcacctgctaagccaggtgggcctgccaagggcctagcacctcgc
cctggggacctcgtctacatggaagactctcccagcttctgccggcccagcaagtactct
ccgggcaccgcgggcagggtgtgttctcgtgatgcaagctgcagcagcctatgctgcggg
cgaggctacgacacccagagccgcgtggtggctttctcctgccactgccaggtgcagtgg
tgctgctatgtggagtgccagcagtgcgcacagcaagaacttgtgtatacctgcaagcgc
tag

KEGG   Cricetulus griseus (Chinese hamster): 100766340
Entry
100766340         CDS       T02813                                 

Gene name
Wnt10b
Definition
(RefSeq) protein Wnt-10b
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100766340 (Wnt10b)
   04390 Hippo signaling pathway
    100766340 (Wnt10b)
   04150 mTOR signaling pathway
    100766340 (Wnt10b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100766340 (Wnt10b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100766340 (Wnt10b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100766340 (Wnt10b)
   05205 Proteoglycans in cancer
    100766340 (Wnt10b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100766340 (Wnt10b)
   05226 Gastric cancer
    100766340 (Wnt10b)
   05217 Basal cell carcinoma
    100766340 (Wnt10b)
   05224 Breast cancer
    100766340 (Wnt10b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100766340 (Wnt10b)
   05022 Pathways of neurodegeneration - multiple diseases
    100766340 (Wnt10b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100766340 (Wnt10b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100766340 (Wnt10b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100766340 (Wnt10b)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100766340 (Wnt10b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100766340
NCBI-ProteinID: XP_027251821
UniProt: G3I6J3
LinkDB
Position
2
AA seq 389 aa
MLEEPGSRPPPLGLAGLLFLALFTRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGKLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSQPSP
IPGSDSSPSPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAIGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTVGSPGTRGRACNKTSRLLDGCGSLCCGRGHNVLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctggaggagcccgggtctcggcctccgcccttgggcctcgcgggtctcctgttcttg
gctttgttcactcgggctctgagcaatgagatcctgggcctaaaacttcccggggagccg
ccgctgacggccaacaccgtgtgcttgaccctgtcgggcctgagtaagcggcagctgggc
ctgtgcctacgcagccccgacgtgacggcgtccgcgctccaaggtctgcacatcgcggtt
cacgagtgtcagcaccagctgcgcgaccagcgttggaactgctcggccctggagggcggc
ggccggctgccgcaccacagcgccatcctcaagcgcggtttccgagagagtgctttctcg
ttctccatgctggctgctggggtcatgcacgctgtagctacagcctgcagcctgggcaag
ctggtgagctgtggctgtggctggaagggtagtggtgaacaggaccggctccgggccaag
ttgctgcagcttcaggcactgtctcggggcaagagttttccacactcacagcccagccct
atccctggctcagactccagccctagcccccaggacacatgggaatggggtggctgtaac
cacgacatggactttggagagaagttctctcgggattttttggattccagagaagctccc
agggacatccaggcaagaatgagaatccataacaacagggtggggcgccaggtggtaact
gaaaacctgaagcggaaatgcaagtgccatggcacatcaggcagctgccaattcaagact
tgttggagggcagctccagagttccgggccattggggcagcattgagggagcggttgggc
agagccatcttcatcgatacccacaaccgcaattctggagccttccagccccgcctacgt
ccccgtcgcctctcaggagagctggtctactttgagaagtctcctgacttctgcgagcga
gaccctacggtgggctcaccgggcacaagaggccgggcttgcaacaagacgagccgcctg
ttggatggctgtggcagcctgtgctgtggccgtgggcacaatgtgctccggcagacacga
gtggagcgctgccactgccgtttccactggtgctgctacgtgctgtgtgatgaatgcaag
gtcacagaatgggtcaatgtgtgtaagtga

KEGG   Cricetulus griseus (Chinese hamster): 100769003
Entry
100769003         CDS       T02813                                 

Gene name
Wnt4
Definition
(RefSeq) protein Wnt-4 isoform X3
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04919  Thyroid hormone signaling pathway
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100769003 (Wnt4)
   04390 Hippo signaling pathway
    100769003 (Wnt4)
   04150 mTOR signaling pathway
    100769003 (Wnt4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100769003 (Wnt4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100769003 (Wnt4)
   04916 Melanogenesis
    100769003 (Wnt4)
  09158 Development and regeneration
   04360 Axon guidance
    100769003 (Wnt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100769003 (Wnt4)
   05205 Proteoglycans in cancer
    100769003 (Wnt4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100769003 (Wnt4)
   05226 Gastric cancer
    100769003 (Wnt4)
   05217 Basal cell carcinoma
    100769003 (Wnt4)
   05224 Breast cancer
    100769003 (Wnt4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100769003 (Wnt4)
   05022 Pathways of neurodegeneration - multiple diseases
    100769003 (Wnt4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100769003 (Wnt4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100769003 (Wnt4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100769003 (Wnt4)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100769003 (Wnt4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 100769003
NCBI-ProteinID: XP_027255556
UniProt: G3HIM9
LinkDB
Position
2
AA seq 351 aa
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQLCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRLVEMHTCR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagcccccgctcgtgtctgcggtcgctgcgactccttgtcttcgccgtgttctcggcc
gccgcgagcaactggctgtacctggccaagctgtcatcggtgggcagcatctccgaagag
gagacctgtgagaagctcaaaggcctgatccagaggcaggtgcagctgtgcaagcggaac
ctggaggtgatggactcggtgcgccggggcgcccagctggccatcgaggagtgccaatac
cagttccggaaccgacgctggaactgctccacactggactccctgcctgtcttcgggaag
gtggtgacacaagggactcgggaggcggcctttgtgtacgccatctcttcagcaggtgtg
gcctttgcagtaacaagggcgtgcagcagtggagagctggaaaagtgtggctgtgaccgg
acagtgcacggggtcagcccacagggtttccagtggtcaggatgctcggacaacatcgcc
tatggcgtagccttctcacagtcctttgtggacgtacgggagagaagcaagggagcctcc
tccagcagggcactcatgaaccttcacaacaacgaggccggcagaaaggccatcttgacc
cacatgcgggtagaatgcaagtgccacggggtgtcaggctcctgcgaggtaaagacgtgc
tggcgagctgtaccacccttccgccaggtgggccatgcactaaaggagaagtttgatggt
gccacagaggtagagccacgtcgtgtgggctcctcccgggcactggtaccacggaatgca
cagttcaagccacatacagatgaggacctggtgtacctggagcccagtccagacttctgc
gagcaggacatgcgcagtggtgtgctgggcacgaggggccgcacatgcaacaaaacgtcc
aaggccattgatggctgtgagctgctgtgctgcggccgtggcttccacacggcacaggtg
gagttggccgagcgctgcggctgcaggttccactggtgctgcttcgtcaagtgccgacag
tgccagcgactcgtggagatgcacacatgccggtga

KEGG   Cricetulus griseus (Chinese hamster): 100770174
Entry
100770174         CDS       T02813                                 

Gene name
Wnt10a
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100770174 (Wnt10a)
   04390 Hippo signaling pathway
    100770174 (Wnt10a)
   04150 mTOR signaling pathway
    100770174 (Wnt10a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100770174 (Wnt10a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100770174 (Wnt10a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100770174 (Wnt10a)
   05205 Proteoglycans in cancer
    100770174 (Wnt10a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100770174 (Wnt10a)
   05226 Gastric cancer
    100770174 (Wnt10a)
   05217 Basal cell carcinoma
    100770174 (Wnt10a)
   05224 Breast cancer
    100770174 (Wnt10a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100770174 (Wnt10a)
   05022 Pathways of neurodegeneration - multiple diseases
    100770174 (Wnt10a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100770174 (Wnt10a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100770174 (Wnt10a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100770174 (Wnt10a)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100770174 (Wnt10a)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100770174
NCBI-ProteinID: XP_027251871
LinkDB
Position
2
AA seq 418 aa
MGSAHPRPWLRLPPRPQPRPELWALLFFLLLLAAAVPRSAPNDILGLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKVPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLQACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPVLPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRNRFHRATLI
RPHNRNGGQLEPGPAAGAPSPAPGTPGLRRKASHSDLVYFEKSPDFCEREPRLDSAGTVG
RLCNKSSSGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgggcagcgcccaccctcgcccctggctgcggctcccaccccggccccagccgcggcct
gagctctgggcgctcctgttcttcctactgctgctggctgccgctgtgcccaggtcagca
cccaacgacatcctgggcctccgcctacccccagagcctgtgctgaacgccaacacagtg
tgcctgacattgcccggcctgagccggcggcagatggaggtgtgtgtgcgtcaccctgac
gtggccgcctctgctatccagggcatccagatcgccatccatgagtgccagcatcagttc
cgggaccagcgctggaactgttccagcctggagacgcggaacaaagtcccctacgagagt
cccatcttcagtagaggttttcgagagagtgctttcgcctatgccatagctgctgccggg
gtggtacacgcagtgtccaacgcgtgcgccctgggtaaactacaggcttgcggttgcgac
gcctccaggcgtggggacgaagaagccttccgtcggaagctgcaccgcttgcagctggat
gcgctgcagcgcggtaagggcctgagccacggggtcccagaacaccctgttttgccccct
gccagcccaggcctgcaggactcctgggagtggggtggctgcagcccagatgtgggtttc
ggagaacgcttctccaaggactttctggactcccgggagcctcatagagacatccatgcg
cgcatgagactccacaacaaccgtgtcggcaggcaggcggtgatggagaacatgcggaga
aagtgcaagtgccatggcacctcaggcagctgccagctcaagacatgctggcaggtgact
cctgaatttcgtgcagtgggggcgctgctgcgcaatcgcttccaccgcgccactctcatc
cgaccacacaaccgtaacggtggccagctggagcccggccccgccgctggggcaccctcg
ccagctcccggcactccagggctgcgccgaaaggccagccactccgacctggtctacttt
gagaaatctcccgacttctgtgagcgcgagccgcgcctggactcggcgggcacagtaggc
cgcctgtgcaataagagcagctcaggccctgacggctgcggcagcatgtgctgtggccgc
ggtcacaacatcctgcgccagacgcgcagtgagcgctgccactgccgtttccactggtgc
tgtttcgtggtctgcgaagaatgccgaatcactgagtgggtcagcgtctgcaagtga

KEGG   Cricetulus griseus (Chinese hamster): 100772978
Entry
100772978         CDS       T02813                                 

Gene name
Wnt7a
Definition
(RefSeq) protein Wnt-7a isoform X2
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100772978 (Wnt7a)
   04390 Hippo signaling pathway
    100772978 (Wnt7a)
   04150 mTOR signaling pathway
    100772978 (Wnt7a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100772978 (Wnt7a)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100772978 (Wnt7a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100772978 (Wnt7a)
   05205 Proteoglycans in cancer
    100772978 (Wnt7a)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100772978 (Wnt7a)
   05226 Gastric cancer
    100772978 (Wnt7a)
   05217 Basal cell carcinoma
    100772978 (Wnt7a)
   05224 Breast cancer
    100772978 (Wnt7a)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100772978 (Wnt7a)
   05022 Pathways of neurodegeneration - multiple diseases
    100772978 (Wnt7a)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100772978 (Wnt7a)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100772978 (Wnt7a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100772978 (Wnt7a)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100772978 (Wnt7a)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 100772978
NCBI-ProteinID: XP_027284679
UniProt: G3GS11
LinkDB
Position
8
AA seq 349 aa
MTRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgacccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcttcggtggtcgctctgggtgcaagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcaatctgccagagccggccggacgccatcatc
gtcataggagaaggctcccaaatgggcctggacgagtgtcagtttcagttccgcaacggc
cgctggaactgctcagctctgggagagcgcactgtcttcgggaaggagcttaaagtgggg
agccgggaggctgccttcacctatgcaattattgctgcgggtgtggcccatgccatcaca
gctgcctgcacccagggcaacctgagcgactgtggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtcttcgtggatgcccgggagatcaagcagaatgcccgtaccctcatg
aacttacacaataacgaggcaggccggaagatcctggaggagaacatgaagctggagtgt
aagtgtcatggggtgtctggctcctgtaccactaagacatgctggaccacgctgccacaa
ttccgagagctaggctacgtgctcaaagacaaatacaacgaggccgtccacgtggaacca
gtgcgcgccagccggaacaagcggcccaccttcctgaagatcaagaagcccctgtcctac
cggaagcccatggacaccgacttggtgtacattgagaagtcacccaattactgtgaagag
gacccagtgacaggcagtgtgggtactcagggccgcgcctgcaataagacagcccctcag
gctagtggctgtgacctcatgtgctgcggccgcggctacaacacacaccagtacgcccga
gtgtggcagtgcaactgcaagttccactggtgctgctacgtcaagtgcaacacgtgcagt
gagcgcacggagatgtacacgtgtaagtga

KEGG   Cricetulus griseus (Chinese hamster): 100774690
Entry
100774690         CDS       T02813                                 

Gene name
Wnt11
Definition
(RefSeq) protein Wnt-11 isoform X1
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100774690 (Wnt11)
   04390 Hippo signaling pathway
    100774690 (Wnt11)
   04150 mTOR signaling pathway
    100774690 (Wnt11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100774690 (Wnt11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100774690 (Wnt11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100774690 (Wnt11)
   05205 Proteoglycans in cancer
    100774690 (Wnt11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100774690 (Wnt11)
   05226 Gastric cancer
    100774690 (Wnt11)
   05217 Basal cell carcinoma
    100774690 (Wnt11)
   05224 Breast cancer
    100774690 (Wnt11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100774690 (Wnt11)
   05022 Pathways of neurodegeneration - multiple diseases
    100774690 (Wnt11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100774690 (Wnt11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100774690 (Wnt11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100774690 (Wnt11)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100774690 (Wnt11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100774690
NCBI-ProteinID: XP_035297243
LinkDB
Position
3
AA seq 354 aa
MRTRPQVCEALLFALALHTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMRTIVHAAREAMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
SISHTIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLETKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgaggacgcggccgcaggtctgtgaggctctgctcttcgccctggcgctccacactggc
gtgtgctatggcatcaagtggctggcactgtccaagacgccagcagccctggcactcaac
cagacacaacactgcaaacagctggaaggcctggtgtctgcgcaggtgcagctctgccgc
agcaacctggagctcatgcgtaccatcgtgcacgcagcacgggaggccatgaaggcctgc
cgcagggccttcgctgacatgcgctggaattgctcctccatcgagcttgctcccaactac
ctgcttgacctggagagaggtacccgggagtcagccttcgtgtatgccctgtcggccgcc
agcatcagccacaccatcgcccgggcctgcacctctggcgacctgcccggctgctcctgc
ggccctgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggctcctcatgggggccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcggctacacaacagtgaagtggggagacaggct
ctacgtgcctccctggaaacgaagtgtaagtgccatggggtgtctggctcctgctccatc
cgcacctgttggaaggggctgcaagagctccgggatgtggctgctgacctcaagacccgc
tacctttcggccacaaaagtggtgcaccggcctatgggcacccgcaagcacttggtgccc
aaggacctggatattaggcctgtgaaggactcagaactagtatatctgcagagctcccct
gacttctgtatgaagaacgagaaagtgggatcccatgggacccaagacaggcagtgcaac
aagacctcaaatggcagtgacagctgcgacctcatgtgctgtgggcgcggctacaacccc
tacacggaccgagtggtggagcgatgccactgcaagtaccattggtgctgctatgtcacc
tgccgcaggtgtgagcgcacagtggagcgctatgtctgcaagtga

KEGG   Cricetulus griseus (Chinese hamster): 100774849
Entry
100774849         CDS       T02813                                 

Definition
(RefSeq) proto-oncogene Wnt-3 isoform X2
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100774849
   04390 Hippo signaling pathway
    100774849
   04150 mTOR signaling pathway
    100774849
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100774849
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100774849
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100774849
   05206 MicroRNAs in cancer
    100774849
   05205 Proteoglycans in cancer
    100774849
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100774849
   05226 Gastric cancer
    100774849
   05217 Basal cell carcinoma
    100774849
   05224 Breast cancer
    100774849
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100774849
   05022 Pathways of neurodegeneration - multiple diseases
    100774849
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100774849
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100774849
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100774849
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100774849
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100774849
NCBI-ProteinID: XP_027283718
LinkDB
Position
7
AA seq 355 aa
MEPHLLGLLLGLLLSGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCVFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctactcggcctcctgctcagtggcaccagggtcctc
gccggctacccaatttggtggtccctggccctgggccagcagtacacatctctgggctcc
cagcctctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgagatcatgcccagcgtagcagaaggtgtgaagctgggcatccaggagtgc
cagcatcagttccggggccgccgatggaactgtaccaccatagatgacagcttggccatc
tttgggcctgtcttggacaaagccacccgcgaatcagccttcgtgcatgccatcgcctcg
gctggtgtagccttcgctgtcacgcgctcctgcgccgaaggcacctccaccatctgcggc
tgcgactcgcatcataaggggccacctggagaaggctggaagtggggaggctgcagcgag
gacgccgacttcggggtgttagtgtctcgggagtttgcggatgcacgggaaaacagacct
gatgcccgctcggctatgaacaagcacaataacgaggcaggccgcacgaccatcctggac
cacatgcacctgaagtgcaaatgccacgggttgtcaggcagctgtgaggtgaagacctgc
tggtgggcccagccagacttccgtgccatcggcgacttcctcaaggacaagtatgacagc
gcctcagagatggtggtggagaagcatcgggagtcccgaggctgggtggagaccctgcga
gccaagtacgcactcttcaagccacccactgagagggacctagtctactatgagaactcc
cccaacttttgtgagcccaacccagagacgggctcctttggcacccgggacaggacttgc
aatgtcacctcccatggcatcgatggctgcgatctgctgtgctgtggccgtggccacaac
acgaggacggagaagcggaaagagaaatgccactgcgtcttccactggtgctgctatgtc
agctgccaagagtgcatccgaatctatgatgtgcacacctgcaagtag

KEGG   Cricetulus griseus (Chinese hamster): 100775075
Entry
100775075         CDS       T02813                                 

Gene name
Wnt8b
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04150  mTOR signaling pathway
cge04310  Wnt signaling pathway
cge04390  Hippo signaling pathway
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04916  Melanogenesis
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05165  Human papillomavirus infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05217  Basal cell carcinoma
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100775075 (Wnt8b)
   04390 Hippo signaling pathway
    100775075 (Wnt8b)
   04150 mTOR signaling pathway
    100775075 (Wnt8b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100775075 (Wnt8b)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100775075 (Wnt8b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100775075 (Wnt8b)
   05205 Proteoglycans in cancer
    100775075 (Wnt8b)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100775075 (Wnt8b)
   05226 Gastric cancer
    100775075 (Wnt8b)
   05217 Basal cell carcinoma
    100775075 (Wnt8b)
   05224 Breast cancer
    100775075 (Wnt8b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100775075 (Wnt8b)
   05022 Pathways of neurodegeneration - multiple diseases
    100775075 (Wnt8b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100775075 (Wnt8b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100775075 (Wnt8b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cge00536]
    100775075 (Wnt8b)
Glycosaminoglycan binding proteins [BR:cge00536]
 Heparan sulfate / Heparin
  Morphogens
   100775075 (Wnt8b)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 100775075
NCBI-ProteinID: XP_027263035
LinkDB
Position
3
AA seq 368 aa
MSPVSQLLRISPSVSQKTMSLTKPAGFFLVTCVFHLSQAWSVNNFLMTGPKAYLVYSSSV
AAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRN
CSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLH
NNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQG
AGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWE
RRSCRRLCGDCGLAVEERRTETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGA
AHKPGKKP
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgtcccctgtctcccaacttttgagaatttctccctctgtgtctcagaagactatgtcc
cttacgaagcccgcgggtttctttcttgtcacttgtgtcttccacctcagccaggcctgg
tcagtgaacaattttctgatgaccggcccaaaggcttacctcgtctactccagcagtgtg
gcagctggtgcccagagtggtattgaagaatgtaaataccagtttgcttgggaccgctgg
aattgtcctgagagagctttgcagctgtccagccatggtggacttcgtagtgctaaccgg
gagacagcatttgtgcatgccatcagttctgccggagtcatgtataccctgactagaaac
tgcagccttggcgactttgacaactgtggttgtgatgactcccgaaatggacaattggga
ggccaaggctggctctggggaggctgcagtgacaacgtgggcttcggagaggcaatttcc
aagcagtttgtggatgccctggagacaggacaggatgcccgggcagccatgaatctgcac
aacaacgaggctggccgcaaggcggtcaagggcaccatgaaacgcacgtgtaagtgccac
ggcgtgtctggcagctgcaccacgcagacctgctggttgcagctgccggagttccgggag
gtaggcgcacacctgaaggagaagtatcacgcggcgctcaaggtggacctgctgcagggc
gcgggcaacagcgcggcgggccgcggcgccatcgccgacaccttccgctccatctccacg
cgcgagctggtccacctggaggactccccagactactgcctggagaacaagaccctgggg
ctgctaggcaccgagggccgagagtgcctgcggcgcgggcgcgccctgggccgctgggag
cgccgcagctgccgcaggctgtgcggggactgcgggctggcggtggaggagcgccgcacc
gagacagtgtccagctgcaactgcaagtttcactggtgctgcgcggtccgctgcgagcag
tgccgccggcgggtcaccaagtacttctgcagccgcgccgagcggccgccgagaggcgct
gcgcacaaacctgggaagaaaccttaa

DBGET integrated database retrieval system