KEGG   Cricetulus griseus (Chinese hamster): 100751412
Entry
100751412         CDS       T02813                                 

Gene name
Ppp3cc
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X6
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04114  Oocyte meiosis
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04720  Long-term potentiation
cge04724  Glutamatergic synapse
cge04728  Dopaminergic synapse
cge04921  Oxytocin signaling pathway
cge04922  Glucagon signaling pathway
cge04924  Renin secretion
cge05010  Alzheimer disease
cge05014  Amyotrophic lateral sclerosis
cge05020  Prion disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05031  Amphetamine addiction
cge05152  Tuberculosis
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100751412 (Ppp3cc)
   04310 Wnt signaling pathway
    100751412 (Ppp3cc)
   04370 VEGF signaling pathway
    100751412 (Ppp3cc)
   04020 Calcium signaling pathway
    100751412 (Ppp3cc)
   04022 cGMP-PKG signaling pathway
    100751412 (Ppp3cc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100751412 (Ppp3cc)
   04218 Cellular senescence
    100751412 (Ppp3cc)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100751412 (Ppp3cc)
   04650 Natural killer cell mediated cytotoxicity
    100751412 (Ppp3cc)
   04660 T cell receptor signaling pathway
    100751412 (Ppp3cc)
   04658 Th1 and Th2 cell differentiation
    100751412 (Ppp3cc)
   04659 Th17 cell differentiation
    100751412 (Ppp3cc)
   04662 B cell receptor signaling pathway
    100751412 (Ppp3cc)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100751412 (Ppp3cc)
   04921 Oxytocin signaling pathway
    100751412 (Ppp3cc)
   04924 Renin secretion
    100751412 (Ppp3cc)
  09156 Nervous system
   04724 Glutamatergic synapse
    100751412 (Ppp3cc)
   04728 Dopaminergic synapse
    100751412 (Ppp3cc)
   04720 Long-term potentiation
    100751412 (Ppp3cc)
  09158 Development and regeneration
   04360 Axon guidance
    100751412 (Ppp3cc)
   04380 Osteoclast differentiation
    100751412 (Ppp3cc)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100751412 (Ppp3cc)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100751412 (Ppp3cc)
   05014 Amyotrophic lateral sclerosis
    100751412 (Ppp3cc)
   05020 Prion disease
    100751412 (Ppp3cc)
   05022 Pathways of neurodegeneration - multiple diseases
    100751412 (Ppp3cc)
  09165 Substance dependence
   05031 Amphetamine addiction
    100751412 (Ppp3cc)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100751412 (Ppp3cc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100751412 (Ppp3cc)
   05170 Human immunodeficiency virus 1 infection
    100751412 (Ppp3cc)
   05163 Human cytomegalovirus infection
    100751412 (Ppp3cc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100751412 (Ppp3cc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100751412 (Ppp3cc)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100751412 (Ppp3cc)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100751412 (Ppp3cc)
SSDB
Motif
Pfam: Metallophos PTEN_C2
Other DBs
NCBI-GeneID: 100751412
NCBI-ProteinID: XP_027246009
LinkDB
Position
1
AA seq 505 aa
MSGSHPQFSTTDRVIKAVPFPPTQRLTLTEVFENGKPKMDVLKNHLVKEGRVEEEVALKI
INDGAAILRQEMTMIEVDAPITVCGDIHGQFFDLMKLFEVGGPPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINYPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEMVYEACMNTFDC
LPLAALLNQQFLCVHGGMSPEINCLDDIRKLDRFTEPPAFGPVCDLLWSDPLEEYGSEKN
QEHYSHNTVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISEDDTEGVSSVRKEIIKNKIRAIGKMARVFSVLREESESVLTLKGL
TPTGTLPLGVLSGGKQTIESATAQATQEAVRGYPHRIRTFEEARGLDRINERMPPRKEGG
QLDGPVKTVHHSHAARRSIHGKKAP
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgtccgggagtcaccctcagttctccacgaccgatcgcgtcatcaaagctgtccccttt
cctccaacccaacggctaactttgacggaagtatttgagaatgggaaacctaaaatggat
gtattgaaaaaccatttggtcaaagaaggccgggtggaagaggaggtagccttaaagata
atcaatgatggggctgccatcctaagacaagagatgaccatgatagaagtggatgctccc
atcacagtgtgtggtgatattcatggacaattctttgacctgatgaagttgtttgaagtt
gggggaccacccagtaatacccgctacctctttctgggtgactatgtggacagaggctac
ttcagtatcgagtgtgtgctgtatttatggagtttaaagattaactatcctaaaacattg
tttctgcttcgaggaaatcatgaatgcaggcatcttacagagtacttcaccttcaaacag
gaatgtcggattaagtattcggaaatggtgtatgaagcgtgtatgaacacattcgactgt
cttcctcttgctgctctcttaaaccagcagtttctctgtgtacatggaggaatgtcacct
gaaattaattgtttagatgacataaggaaattagataggtttaccgaacctcctgctttt
gggccagtgtgtgacctgctttggtctgatcccttagaggagtatggcagtgagaagaac
caggagcactatagccacaacactgtccgaggctgctcctacttcttcagttaccccgct
gtttgtgaatttttacagaacaacagtttattatcaataatcagagcccatgaagcccag
gatgctgggtaccgaatgtacaggaagagccaagcaacgggctttccatcactcattaca
attttctctgcccctaattacctcgatgtttataacaataaagctgcagtgttgaaatat
gaaaacaatgtcatgaacatcaggcagtttaactgctctccacacccctactggcttcca
aatttcatggatgttttcacgtggtctttgcctttcgttggagaaaaagtcacagagatg
ttggtcaatattctcaacatatgctctgatgatgagctcatctccgaggacgacacagaa
ggagtctcttcagttcgaaaagagatcatcaagaataaaatcagagccattgggaaaatg
gcacgggtcttttcggttcttcgggaggagagtgagagtgtgctaaccctcaagggcctc
actcccacaggcacactccccttgggggtcctctctggaggaaagcagaccattgagagt
gccacagcacaagcgacacaggaagccgtcagagggtatccacacaggatccgaaccttt
gaagaagcccgaggtctagacagaattaatgagcgaatgccaccccgaaaagagggtggg
caacttgacgggccggtaaagacggtacaccactcacatgctgcacgaaggagcatccat
gggaagaaagccccgtaa

KEGG   Cricetulus griseus (Chinese hamster): 100752571
Entry
100752571         CDS       T02813                                 

Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform isoform X2
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04114  Oocyte meiosis
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04720  Long-term potentiation
cge04724  Glutamatergic synapse
cge04728  Dopaminergic synapse
cge04921  Oxytocin signaling pathway
cge04922  Glucagon signaling pathway
cge04924  Renin secretion
cge05010  Alzheimer disease
cge05014  Amyotrophic lateral sclerosis
cge05020  Prion disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05031  Amphetamine addiction
cge05152  Tuberculosis
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100752571
   04310 Wnt signaling pathway
    100752571
   04370 VEGF signaling pathway
    100752571
   04020 Calcium signaling pathway
    100752571
   04022 cGMP-PKG signaling pathway
    100752571
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100752571
   04218 Cellular senescence
    100752571
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100752571
   04650 Natural killer cell mediated cytotoxicity
    100752571
   04660 T cell receptor signaling pathway
    100752571
   04658 Th1 and Th2 cell differentiation
    100752571
   04659 Th17 cell differentiation
    100752571
   04662 B cell receptor signaling pathway
    100752571
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100752571
   04921 Oxytocin signaling pathway
    100752571
   04924 Renin secretion
    100752571
  09156 Nervous system
   04724 Glutamatergic synapse
    100752571
   04728 Dopaminergic synapse
    100752571
   04720 Long-term potentiation
    100752571
  09158 Development and regeneration
   04360 Axon guidance
    100752571
   04380 Osteoclast differentiation
    100752571
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100752571
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100752571
   05014 Amyotrophic lateral sclerosis
    100752571
   05020 Prion disease
    100752571
   05022 Pathways of neurodegeneration - multiple diseases
    100752571
  09165 Substance dependence
   05031 Amphetamine addiction
    100752571
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100752571
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100752571
   05170 Human immunodeficiency virus 1 infection
    100752571
   05163 Human cytomegalovirus infection
    100752571
   05167 Kaposi sarcoma-associated herpesvirus infection
    100752571
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100752571
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100752571
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100752571
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 100752571
NCBI-ProteinID: XP_027251585
LinkDB
Position
1
AA seq 511 aa
MSESKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAM
PSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtccgagtccaaggcgattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gttccatttccgccaagtcaccggctgacagcaaaggaggtgtttgataatgatgggaag
cctcgtgtggatatcttaaaagcacatctcatgaaggagggcaggctggaggaaagtgtc
gcattgagaataataacagagggtgcttcgattcttcgacaggaaaaaaacttgctggat
attgatgccccagtcacagtgtgtggggacatccatggacaattctttgacttgatgaag
ctctttgaagtgggaggatcgcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgtgtttatgatgcctgtatggat
gccttcgactgccttcccctggctgcactgatgaaccaacagttcctgtgtgtacatggt
ggtttgtctccagagattaacactctagatgacatcagaaaattagaccgattcaaagaa
ccacctgcttatgggcccatgtgtgacatcctgtggtcagatcccctggaggactttgga
aatgagaagacgcaggaacatttcactcacaacacagtcagggggtgttcatacttctac
agttatccagctgtatgtgacttcctgcaacacaataacttattgtctatactccgagcc
cacgaagcccaggacgcagggtaccgcatgtacaggaaaagccaaacaacaggcttccct
tctctgattacaattttctcagcaccaaattacttagatgtgtacaataacaaagctgca
gtgttgaagtacgagaacaatgtgatgaacatcagacagttcaactgctctccccatccg
tactggctcccaaatttcatggacgttttcacctggtcgctgccgtttgtgggggagaaa
gtgactgagatgctggtaaatgtcctcaacatctgctcagacgatgagctggggtcagag
gaagatggatttgacggagccacagccgcagcccggaaggaggtcatcaggaacaagatc
cgagcaataggcaaaatggccagagtgttctcagttctcagagaagagagtgagagtgtt
ctgaccctgaagggcctgaccccaacaggcatgctccccagtggcgtgctttctggaggg
aagcaaaccctgcaaagcgctatcaaaggattttcaccacaacataagatcactagcttc
gaagaggcgaagggcttagaccgaattaacgagaggatgccacctcgcagagatgccatg
ccctccgacgccaaccttaactccatcaacaaggctctcgcctcagagactaacggcacg
gacagcaacggcagtaatagcagcaatattcagtga

KEGG   Cricetulus griseus (Chinese hamster): 100754314
Entry
100754314         CDS       T02813                                 

Gene name
Ppp3r2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04114  Oocyte meiosis
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04720  Long-term potentiation
cge04724  Glutamatergic synapse
cge04921  Oxytocin signaling pathway
cge04922  Glucagon signaling pathway
cge04924  Renin secretion
cge05010  Alzheimer disease
cge05014  Amyotrophic lateral sclerosis
cge05020  Prion disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05031  Amphetamine addiction
cge05152  Tuberculosis
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100754314 (Ppp3r2)
   04310 Wnt signaling pathway
    100754314 (Ppp3r2)
   04370 VEGF signaling pathway
    100754314 (Ppp3r2)
   04020 Calcium signaling pathway
    100754314 (Ppp3r2)
   04022 cGMP-PKG signaling pathway
    100754314 (Ppp3r2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100754314 (Ppp3r2)
   04218 Cellular senescence
    100754314 (Ppp3r2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100754314 (Ppp3r2)
   04650 Natural killer cell mediated cytotoxicity
    100754314 (Ppp3r2)
   04660 T cell receptor signaling pathway
    100754314 (Ppp3r2)
   04658 Th1 and Th2 cell differentiation
    100754314 (Ppp3r2)
   04659 Th17 cell differentiation
    100754314 (Ppp3r2)
   04662 B cell receptor signaling pathway
    100754314 (Ppp3r2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100754314 (Ppp3r2)
   04921 Oxytocin signaling pathway
    100754314 (Ppp3r2)
   04924 Renin secretion
    100754314 (Ppp3r2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100754314 (Ppp3r2)
   04720 Long-term potentiation
    100754314 (Ppp3r2)
  09158 Development and regeneration
   04360 Axon guidance
    100754314 (Ppp3r2)
   04380 Osteoclast differentiation
    100754314 (Ppp3r2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100754314 (Ppp3r2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100754314 (Ppp3r2)
   05014 Amyotrophic lateral sclerosis
    100754314 (Ppp3r2)
   05020 Prion disease
    100754314 (Ppp3r2)
   05022 Pathways of neurodegeneration - multiple diseases
    100754314 (Ppp3r2)
  09165 Substance dependence
   05031 Amphetamine addiction
    100754314 (Ppp3r2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100754314 (Ppp3r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100754314 (Ppp3r2)
   05170 Human immunodeficiency virus 1 infection
    100754314 (Ppp3r2)
   05163 Human cytomegalovirus infection
    100754314 (Ppp3r2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100754314 (Ppp3r2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100754314 (Ppp3r2)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100754314 (Ppp3r2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 100754314
NCBI-ProteinID: XP_027258896
LinkDB
Position
2
AA seq 170 aa
MGNETSYQSAMCNHFDQDEIRRLGRSFRKMDLDKSGSLSIDEFMSLPELQQNPLVSRVID
IFDTDGNGEVDFHEFIMGTSQFSVKGDEEQKLRFAFRVYDMDKDGYISNGELFHVLKMMV
GNNLMDWQLQQLVDKTILVLDKDGDGRISFTEFCDVVKNMEIHKKLVVFV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaacgagaccagctaccaatccgcgatgtgcaaccactttgaccaggatgagatt
agaaggttgggcagaagtttcaggaagatggacttggacaaatcgggctccctgagcata
gatgagtttatgtcgctgcctgagctgcagcagaacccactggtaagtcgagtgatcgac
atcttcgacacggatggcaatggggaagtggacttccatgagttcatcatgggcacctcg
cagttcagcgtcaagggcgacgaagaacagaagttaagattcgccttcagagtctacgac
atggacaaagatggctacatctccaatggggagctcttccacgtgctgaagatgatggtg
ggtaacaacctcatggactggcagctgcagcagctggtggacaaaactatcttggtcctg
gataaggacggcgatggccggatatccttcacagagttctgtgatgtggtgaaaaacatg
gagatccacaagaagttggtcgtgtttgtgtga

KEGG   Cricetulus griseus (Chinese hamster): 100764987
Entry
100764987         CDS       T02813                                 

Gene name
Ppp3cb
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X1
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04114  Oocyte meiosis
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04720  Long-term potentiation
cge04724  Glutamatergic synapse
cge04728  Dopaminergic synapse
cge04921  Oxytocin signaling pathway
cge04922  Glucagon signaling pathway
cge04924  Renin secretion
cge05010  Alzheimer disease
cge05014  Amyotrophic lateral sclerosis
cge05020  Prion disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05031  Amphetamine addiction
cge05152  Tuberculosis
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100764987 (Ppp3cb)
   04310 Wnt signaling pathway
    100764987 (Ppp3cb)
   04370 VEGF signaling pathway
    100764987 (Ppp3cb)
   04020 Calcium signaling pathway
    100764987 (Ppp3cb)
   04022 cGMP-PKG signaling pathway
    100764987 (Ppp3cb)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100764987 (Ppp3cb)
   04218 Cellular senescence
    100764987 (Ppp3cb)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100764987 (Ppp3cb)
   04650 Natural killer cell mediated cytotoxicity
    100764987 (Ppp3cb)
   04660 T cell receptor signaling pathway
    100764987 (Ppp3cb)
   04658 Th1 and Th2 cell differentiation
    100764987 (Ppp3cb)
   04659 Th17 cell differentiation
    100764987 (Ppp3cb)
   04662 B cell receptor signaling pathway
    100764987 (Ppp3cb)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100764987 (Ppp3cb)
   04921 Oxytocin signaling pathway
    100764987 (Ppp3cb)
   04924 Renin secretion
    100764987 (Ppp3cb)
  09156 Nervous system
   04724 Glutamatergic synapse
    100764987 (Ppp3cb)
   04728 Dopaminergic synapse
    100764987 (Ppp3cb)
   04720 Long-term potentiation
    100764987 (Ppp3cb)
  09158 Development and regeneration
   04360 Axon guidance
    100764987 (Ppp3cb)
   04380 Osteoclast differentiation
    100764987 (Ppp3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100764987 (Ppp3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100764987 (Ppp3cb)
   05014 Amyotrophic lateral sclerosis
    100764987 (Ppp3cb)
   05020 Prion disease
    100764987 (Ppp3cb)
   05022 Pathways of neurodegeneration - multiple diseases
    100764987 (Ppp3cb)
  09165 Substance dependence
   05031 Amphetamine addiction
    100764987 (Ppp3cb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100764987 (Ppp3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100764987 (Ppp3cb)
   05170 Human immunodeficiency virus 1 infection
    100764987 (Ppp3cb)
   05163 Human cytomegalovirus infection
    100764987 (Ppp3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100764987 (Ppp3cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100764987 (Ppp3cb)
Enzymes [BR:cge01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100764987 (Ppp3cb)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100764987 (Ppp3cb)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 100764987
NCBI-ProteinID: XP_035309090
LinkDB
Position
1
AA seq 480 aa
MDGIPRVDVLKNHLVKEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFF
DLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHL
TEYFTFKQECKIKYSERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLD
RFKEPPAFGPMCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS
IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNC
SPHPYWLPNFMDVFTWSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEI
IRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAE
KAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHSAQ
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggatgggatacccagggttgatgttctaaagaaccacctggtaaaagaaggtcgggta
gatgaagaaattgcacttagaattatcaatgagggcgctgccatactgcggcgggagaaa
accatgatagaagtagaagctccaattacagtgtgtggtgacatccatggccaatttttt
gatctgatgaaactttttgaagtaggaggatcacctgctaatacacgatacctttttctt
ggtgattatgtggacagaggttattttagtatagagtgtgttttatatttatgggtcttg
aagattctatacccaagcacattattccttctgagaggcaaccatgaatgcagacacctt
actgaatattttacctttaagcaggaatgtaaaattaagtattctgaaagagtctatgaa
gcttgtatggaagcttttgacagcttgccccttgctgcacttctaaaccaacaatttctt
tgtgttcatggtggactttcaccggaaatacacacactggatgatattaggagattagat
agatttaaagagccacctgcatttggaccaatgtgtgacttgctatggtctgatccttct
gaagactttggaaatgaaaaatcacaagaacattttagtcataatacggttcgaggatgt
tcttatttttataactatccagcagtgtgtgaatttttgcaaaacaataatttgttatcg
attattagagctcatgaagctcaagatgcaggctatagaatgtacagaaaaagtcaaact
acagggttcccttcattaataacaattttttcggcacctaattacttagatgtctacaat
aataaagctgctgtactaaagtatgaaaataatgtgatgaatattcgacagtttaattgt
tctccacatccttactggttgcccaattttatggatgtcttcacatggtctttaccgttt
gttggagaaaaagtgacagaaatgttggtaaatgttctgagtatttgctctgatgatgaa
ctaatgacagaaggtgaagaccagtttgatgtaggttcagctgcagcccggaaagaaatc
ataagaaacaaaatcagagcaattggcaagatggcaagagtcttctctgttctcagggag
gagagtgaaagcgtgctgacactcaagggcctgactcccacagggatgttgcctagtgga
gtgttggctggaggacggcagaccttgcaaagtgccacagttgaggctattgaggctgaa
aaagcaatacgaggattctctccaccacatagaatctgcagttttgaagaggcaaagggt
ttggataggatcaatgagagaatgccaccccggaaagatgctgtacagcaggatggtttc
aattccctgaacaccgcacatgccactgagaaccacgggactggcaaccatagtgcccag
tga

KEGG   Cricetulus griseus (Chinese hamster): 100773706
Entry
100773706         CDS       T02813                                 

Gene name
Ppp3r1
Definition
(RefSeq) calcineurin subunit B type 1 isoform X2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge04010  MAPK signaling pathway
cge04020  Calcium signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04114  Oocyte meiosis
cge04218  Cellular senescence
cge04310  Wnt signaling pathway
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04380  Osteoclast differentiation
cge04625  C-type lectin receptor signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04658  Th1 and Th2 cell differentiation
cge04659  Th17 cell differentiation
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04720  Long-term potentiation
cge04724  Glutamatergic synapse
cge04921  Oxytocin signaling pathway
cge04922  Glucagon signaling pathway
cge04924  Renin secretion
cge05010  Alzheimer disease
cge05014  Amyotrophic lateral sclerosis
cge05020  Prion disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05031  Amphetamine addiction
cge05152  Tuberculosis
cge05163  Human cytomegalovirus infection
cge05166  Human T-cell leukemia virus 1 infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100773706 (Ppp3r1)
   04310 Wnt signaling pathway
    100773706 (Ppp3r1)
   04370 VEGF signaling pathway
    100773706 (Ppp3r1)
   04020 Calcium signaling pathway
    100773706 (Ppp3r1)
   04022 cGMP-PKG signaling pathway
    100773706 (Ppp3r1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100773706 (Ppp3r1)
   04218 Cellular senescence
    100773706 (Ppp3r1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100773706 (Ppp3r1)
   04650 Natural killer cell mediated cytotoxicity
    100773706 (Ppp3r1)
   04660 T cell receptor signaling pathway
    100773706 (Ppp3r1)
   04658 Th1 and Th2 cell differentiation
    100773706 (Ppp3r1)
   04659 Th17 cell differentiation
    100773706 (Ppp3r1)
   04662 B cell receptor signaling pathway
    100773706 (Ppp3r1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100773706 (Ppp3r1)
   04921 Oxytocin signaling pathway
    100773706 (Ppp3r1)
   04924 Renin secretion
    100773706 (Ppp3r1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100773706 (Ppp3r1)
   04720 Long-term potentiation
    100773706 (Ppp3r1)
  09158 Development and regeneration
   04360 Axon guidance
    100773706 (Ppp3r1)
   04380 Osteoclast differentiation
    100773706 (Ppp3r1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100773706 (Ppp3r1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100773706 (Ppp3r1)
   05014 Amyotrophic lateral sclerosis
    100773706 (Ppp3r1)
   05020 Prion disease
    100773706 (Ppp3r1)
   05022 Pathways of neurodegeneration - multiple diseases
    100773706 (Ppp3r1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100773706 (Ppp3r1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100773706 (Ppp3r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100773706 (Ppp3r1)
   05170 Human immunodeficiency virus 1 infection
    100773706 (Ppp3r1)
   05163 Human cytomegalovirus infection
    100773706 (Ppp3r1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100773706 (Ppp3r1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100773706 (Ppp3r1)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100773706 (Ppp3r1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 100773706
NCBI-ProteinID: XP_027243879
LinkDB
Position
1
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcgagttaccctttggaaatgtgctcacactttgatgctgatgaaatc
aaaaggctaggaaagagattcaagaagcttgatttggacaattccggttctttgagcgtg
gaagagttcatgtctctgcctgagttacaacagaaccctttagtacagcgggtaatagac
atattcgacacagatgggaacggagaagtagacttcaaagaattcattgaaggagtctct
cagttcagtgtcaaaggcgataaggaacagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtgttgaagatgatggtg
gggaacaacctgaaagatacgcagttacagcagattgtagacaaaaccataataaatgcg
gataaggatggagatggaagaatatcctttgaggaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtggatgtgtga

DBGET integrated database retrieval system