KEGG   Cricetulus griseus (Chinese hamster): 100751427Help
Entry
100751427         CDS       T02813                                 

Gene name
Sord
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00040  Pentose and glucuronate interconversions
cge00051  Fructose and mannose metabolism
cge01100  Metabolic pathways
Module
cge_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100751427 (Sord)
   00051 Fructose and mannose metabolism
    100751427 (Sord)
Enzymes [BR:cge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     100751427 (Sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 2-Hacid_dh_C Pyr_redox_2 Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 100751427
NCBI-ProteinID: XP_027277797
UniProt: G3H0S4
LinkDB All DBs
Position
6
AA seq 357 aa AA seqDB search
MAAPAKAENLSLVVHGPGDIRLENYPIPEPGPNDVLLKMHSVGICGSDVHYWQHGRIGDF
IVKKPMVLGHEAAGTVIKVGDMVKHLKPGDRVAIEPGVPRETDEFCKIGRYNLSPSIFFC
ATPPDDGNLCRFYKHNADFCYKLPDSVTFEEGALIEPLSVGIYACRRGSVSLGKKVLVCG
AGPIGIVTLLVAKAMGASQVLVMDLSSSRLAKAKEVGADFTLHISKEPPLEVASKVESML
GRKPEVTIECTGAESSIQTGIYATHSGGTLVIVGLGSEMVNLPLVHAAVREVDIKGVFRY
CNTWPMAISMLASKALNVKPLVTHRFPLEKAVEAFEATKKGVGLKVMIKCDPSDQNP
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccagctaaggccgagaacctgtccctggtggtgcacggacctggggacatt
cgcttggagaactacccaatccctgagccaggcccaaatgatgtgctgctaaagatgcat
tctgtggggatctgcggatcagatgttcactactggcagcatggccgaattggagatttt
attgtgaaaaagccaatggtgcttgggcatgaagctgcagggacagtcataaaagtagga
gacatggtgaagcatctaaaaccaggcgatcgggttgccatcgagcccggtgttccccga
gaaacagatgaattctgcaagattggccgatacaatctaagcccctccatcttcttctgt
gccacacccccagatgacgggaacctctgtcgcttctacaagcacaatgctgatttctgc
tacaagcttcctgacagtgtcacctttgaagaaggggccctgattgagcctctctctgtg
gggatctatgcctgccgccgaggttcagtttctctggggaagaaggtccttgtgtgtgga
gctgggccaattgggatagtcactttgcttgtggccaaagcaatgggagcttctcaagtg
ctggtgatggacctgtcttcctctcggttggccaaagccaaggaagttggagctgatttc
accctccatatctccaaggagccccctctggaagttgccagtaaagtggaaagcatgctg
gggagaaagccggaagtcactattgaatgcacaggggctgaatcctccatccagaccggc
atctatgccactcactctggtgggaccttggtgattgtaggattgggctccgagatggtc
aatttacccctagtgcacgcagctgtgagggaggtggatatcaagggcgtgtttagatac
tgcaacacgtggccaatggcgatttccatgcttgcatcaaaggccttgaatgtaaagcct
ttagttacccataggttccctctggagaaggctgttgaagcctttgaagcaaccaaaaag
ggagtggggctgaaagttatgatcaagtgtgaccccagtgaccagaacccctaa

DBGET integrated database retrieval system