KEGG   Cricetulus griseus (Chinese hamster): 100751432
Entry
100751432         CDS       T02813                                 

Gene name
Araf
Definition
(RefSeq) serine/threonine-protein kinase A-Raf isoform X5
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04068  FoxO signaling pathway
cge04270  Vascular smooth muscle contraction
cge04650  Natural killer cell mediated cytotoxicity
cge04720  Long-term potentiation
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04928  Parathyroid hormone synthesis, secretion and action
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100751432 (Araf)
   04012 ErbB signaling pathway
    100751432 (Araf)
   04068 FoxO signaling pathway
    100751432 (Araf)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100751432 (Araf)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100751432 (Araf)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100751432 (Araf)
   04914 Progesterone-mediated oocyte maturation
    100751432 (Araf)
   04928 Parathyroid hormone synthesis, secretion and action
    100751432 (Araf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100751432 (Araf)
  09156 Nervous system
   04726 Serotonergic synapse
    100751432 (Araf)
   04720 Long-term potentiation
    100751432 (Araf)
   04730 Long-term depression
    100751432 (Araf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100751432 (Araf)
   05205 Proteoglycans in cancer
    100751432 (Araf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100751432 (Araf)
   05212 Pancreatic cancer
    100751432 (Araf)
   05225 Hepatocellular carcinoma
    100751432 (Araf)
   05226 Gastric cancer
    100751432 (Araf)
   05214 Glioma
    100751432 (Araf)
   05221 Acute myeloid leukemia
    100751432 (Araf)
   05220 Chronic myeloid leukemia
    100751432 (Araf)
   05218 Melanoma
    100751432 (Araf)
   05211 Renal cell carcinoma
    100751432 (Araf)
   05219 Bladder cancer
    100751432 (Araf)
   05215 Prostate cancer
    100751432 (Araf)
   05213 Endometrial cancer
    100751432 (Araf)
   05224 Breast cancer
    100751432 (Araf)
   05223 Non-small cell lung cancer
    100751432 (Araf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100751432 (Araf)
   05022 Pathways of neurodegeneration - multiple diseases
    100751432 (Araf)
  09165 Substance dependence
   05034 Alcoholism
    100751432 (Araf)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100751432 (Araf)
   05160 Hepatitis C
    100751432 (Araf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100751432 (Araf)
   01522 Endocrine resistance
    100751432 (Araf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100751432 (Araf)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100751432 (Araf)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100751432 (Araf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 100751432
NCBI-ProteinID: XP_027288078
LinkDB
Position
X
AA seq 609 aa
MEPPRGPPASGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRQQFYHSIQDLSGGSRQQEVPSNLPVNELL
TPQGPSLFSISPRTQPRDLEHFSFPAPANPPLQRIRSTSTPNVHMVSTTAPMDSSLMQFT
AQSFSTDAAGKGGDGAPRGSPSPASVSSGRKSPHSKSPSEQRERKSLAEEKKKVKNLGYR
DSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEMQV
LRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQGM
DYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAAEV
IRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIFSN
CPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELPAC
LLSAARLVP
NT seq 1830 nt   +upstreamnt  +downstreamnt
atggaaccaccacgaggccctcctgctagtggggctgagccatctcgggcagttggcact
gtcaaagtgtacctgcctaacaagcaacgcacagtggtgactgtccgggatggcatgagt
gtctatgattcattggacaaggccctcaaggttcggggtctcaatcaggattgctgcgtg
gtctacagactcatcaaaggaaggaaaacagtcactgcctgggacacagccattgcaccc
ctggatggtgaagagctcattgtggaggtcctagaagatgtgccactgaccatgcacaat
tttgtacggaagacattcttcagcctggccttctgtgacttctgccttaagtttctgttc
catggcttccgctgccaaacctgtggctacaagttccaccagcattgttcctccaaggtc
cccacagtctgcgttgacatgagtaccaaccgccaacagttctaccacagcattcaggat
ttgtctggaggctccaggcagcaagaggttccctcaaatctccctgtgaatgagctgcta
accccccagggtcccagccttttctctatcagcccccgcacccagccccgtgacctggag
cacttctccttccctgcccctgccaatcccccactgcagcgcatccgctctacatctact
cctaacgtccacatggtcagcaccacagcgcccatggactccagcctcatgcagttcact
gctcagagcttcagcaccgatgctgctggtaaaggtggtgatggagcaccccgtggtagc
cctagcccagctagtgtgtcctcggggaggaagtccccacattccaagtcaccgtcagag
cagcgagagcggaagtccttggcagaagaaaagaaaaaagtgaagaacctggggtaccgg
gactcaggctattactgggaggtgccacccagtgaggtacagctgttgaagaggattggg
acaggctcttttggcactgtgtttcgggggcgttggcatggtgatgtagctgtgaaagtg
ctcaaggtggcgcaacctactgctgaacaggcccaggccttcaagaatgagatgcaagta
ctcaggaagacacgacatgtcaacattttgctgttcatgggtttcatgacccggccgggg
tttgctatcatcacacaatggtgtgagggttccagtctctaccaccacctacatgtggct
gacacgcgctttgacatggtccagctcattgatgtggcccggcagactgcccagggcatg
gactacctccacgccaagaacatcatccaccgagatctcaagtccaacaatatcttccta
catgagggactcacagtcaagattggtgacttcggcctggccacagtgaagacacggtgg
agtggggcccagcccttagagcagccctcagggtctgtgttatggatggcagctgaggtg
attcgtatgcaggacccgaacccctacagcttccagtcggatgtctatgcctacggtgtt
gtgctttatgagcttatgactggctcactgccctacagccacattggcagccgtgaccag
atcatctttatggtgggccgtggctatctgtctccggacctcagcaaaatcttcagtaat
tgccccaaggccatgaggcgcctgctgtctgactgcctcaagttccagcgggaggagcgg
cccctatttccccagatcctggccacgatcgagctactgcagcggtcactccccaagatt
gagcggagtgcctccgaaccctccttgcaccgcacccaggctgacgagttgcctgcctgc
cttctcagcgcagcccgccttgtgccttag

KEGG   Cricetulus griseus (Chinese hamster): 100769018
Entry
100769018         CDS       T02813                                 

Gene name
Raf1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04014  Ras signaling pathway
cge04015  Rap1 signaling pathway
cge04022  cGMP-PKG signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04071  Sphingolipid signaling pathway
cge04072  Phospholipase D signaling pathway
cge04140  Autophagy - animal
cge04150  mTOR signaling pathway
cge04151  PI3K-Akt signaling pathway
cge04210  Apoptosis
cge04218  Cellular senescence
cge04270  Vascular smooth muscle contraction
cge04360  Axon guidance
cge04370  VEGF signaling pathway
cge04371  Apelin signaling pathway
cge04510  Focal adhesion
cge04540  Gap junction
cge04550  Signaling pathways regulating pluripotency of stem cells
cge04613  Neutrophil extracellular trap formation
cge04625  C-type lectin receptor signaling pathway
cge04630  JAK-STAT signaling pathway
cge04650  Natural killer cell mediated cytotoxicity
cge04660  T cell receptor signaling pathway
cge04662  B cell receptor signaling pathway
cge04664  Fc epsilon RI signaling pathway
cge04666  Fc gamma R-mediated phagocytosis
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04912  GnRH signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04915  Estrogen signaling pathway
cge04916  Melanogenesis
cge04917  Prolactin signaling pathway
cge04919  Thyroid hormone signaling pathway
cge04921  Oxytocin signaling pathway
cge04926  Relaxin signaling pathway
cge04928  Parathyroid hormone synthesis, secretion and action
cge04929  GnRH secretion
cge04935  Growth hormone synthesis, secretion and action
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05132  Salmonella infection
cge05152  Tuberculosis
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05163  Human cytomegalovirus infection
cge05164  Influenza A
cge05165  Human papillomavirus infection
cge05167  Kaposi sarcoma-associated herpesvirus infection
cge05170  Human immunodeficiency virus 1 infection
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05206  MicroRNAs in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
cge05230  Central carbon metabolism in cancer
cge05231  Choline metabolism in cancer
cge05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100769018 (Raf1)
   04012 ErbB signaling pathway
    100769018 (Raf1)
   04014 Ras signaling pathway
    100769018 (Raf1)
   04015 Rap1 signaling pathway
    100769018 (Raf1)
   04370 VEGF signaling pathway
    100769018 (Raf1)
   04371 Apelin signaling pathway
    100769018 (Raf1)
   04630 JAK-STAT signaling pathway
    100769018 (Raf1)
   04068 FoxO signaling pathway
    100769018 (Raf1)
   04072 Phospholipase D signaling pathway
    100769018 (Raf1)
   04071 Sphingolipid signaling pathway
    100769018 (Raf1)
   04024 cAMP signaling pathway
    100769018 (Raf1)
   04022 cGMP-PKG signaling pathway
    100769018 (Raf1)
   04151 PI3K-Akt signaling pathway
    100769018 (Raf1)
   04150 mTOR signaling pathway
    100769018 (Raf1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100769018 (Raf1)
  09143 Cell growth and death
   04210 Apoptosis
    100769018 (Raf1)
   04218 Cellular senescence
    100769018 (Raf1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100769018 (Raf1)
   04540 Gap junction
    100769018 (Raf1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100769018 (Raf1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100769018 (Raf1)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    100769018 (Raf1)
   04625 C-type lectin receptor signaling pathway
    100769018 (Raf1)
   04650 Natural killer cell mediated cytotoxicity
    100769018 (Raf1)
   04660 T cell receptor signaling pathway
    100769018 (Raf1)
   04662 B cell receptor signaling pathway
    100769018 (Raf1)
   04664 Fc epsilon RI signaling pathway
    100769018 (Raf1)
   04666 Fc gamma R-mediated phagocytosis
    100769018 (Raf1)
   04062 Chemokine signaling pathway
    100769018 (Raf1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100769018 (Raf1)
   04929 GnRH secretion
    100769018 (Raf1)
   04912 GnRH signaling pathway
    100769018 (Raf1)
   04915 Estrogen signaling pathway
    100769018 (Raf1)
   04914 Progesterone-mediated oocyte maturation
    100769018 (Raf1)
   04917 Prolactin signaling pathway
    100769018 (Raf1)
   04921 Oxytocin signaling pathway
    100769018 (Raf1)
   04926 Relaxin signaling pathway
    100769018 (Raf1)
   04935 Growth hormone synthesis, secretion and action
    100769018 (Raf1)
   04919 Thyroid hormone signaling pathway
    100769018 (Raf1)
   04928 Parathyroid hormone synthesis, secretion and action
    100769018 (Raf1)
   04916 Melanogenesis
    100769018 (Raf1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100769018 (Raf1)
  09156 Nervous system
   04726 Serotonergic synapse
    100769018 (Raf1)
   04720 Long-term potentiation
    100769018 (Raf1)
   04730 Long-term depression
    100769018 (Raf1)
   04722 Neurotrophin signaling pathway
    100769018 (Raf1)
  09158 Development and regeneration
   04360 Axon guidance
    100769018 (Raf1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100769018 (Raf1)
   05206 MicroRNAs in cancer
    100769018 (Raf1)
   05205 Proteoglycans in cancer
    100769018 (Raf1)
   05230 Central carbon metabolism in cancer
    100769018 (Raf1)
   05231 Choline metabolism in cancer
    100769018 (Raf1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100769018 (Raf1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100769018 (Raf1)
   05212 Pancreatic cancer
    100769018 (Raf1)
   05225 Hepatocellular carcinoma
    100769018 (Raf1)
   05226 Gastric cancer
    100769018 (Raf1)
   05214 Glioma
    100769018 (Raf1)
   05221 Acute myeloid leukemia
    100769018 (Raf1)
   05220 Chronic myeloid leukemia
    100769018 (Raf1)
   05218 Melanoma
    100769018 (Raf1)
   05211 Renal cell carcinoma
    100769018 (Raf1)
   05219 Bladder cancer
    100769018 (Raf1)
   05215 Prostate cancer
    100769018 (Raf1)
   05213 Endometrial cancer
    100769018 (Raf1)
   05224 Breast cancer
    100769018 (Raf1)
   05223 Non-small cell lung cancer
    100769018 (Raf1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100769018 (Raf1)
   05022 Pathways of neurodegeneration - multiple diseases
    100769018 (Raf1)
  09165 Substance dependence
   05034 Alcoholism
    100769018 (Raf1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100769018 (Raf1)
   05152 Tuberculosis
    100769018 (Raf1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100769018 (Raf1)
   05161 Hepatitis B
    100769018 (Raf1)
   05160 Hepatitis C
    100769018 (Raf1)
   05164 Influenza A
    100769018 (Raf1)
   05163 Human cytomegalovirus infection
    100769018 (Raf1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100769018 (Raf1)
   05165 Human papillomavirus infection
    100769018 (Raf1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100769018 (Raf1)
   01522 Endocrine resistance
    100769018 (Raf1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100769018 (Raf1)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100769018 (Raf1)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100769018 (Raf1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 100769018
NCBI-ProteinID: XP_027284970
UniProt: G3HVN3
LinkDB
Position
8
AA seq 648 aa
MEHIQGAWKSISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDSGVPALPSLTMRRMRESVSRMPASSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQLQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSRLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggagcttggaagtcgatcagcaatggctttggactcaaagatgcg
gtatttgatggctccagctgcatctctccaacaattgttcagcagtttggctatcagcgc
cgggcgtcagatgatggcaaactcacggattcatctaagacaagcaacactattcgagtt
ttcttgccgaataagcaaaggacagtggtcaatgtgcggaatggaatgagcttgcacgac
tgccttatgaaagctctcaaggtgaggggtctgcagccagagtgttgtgcagtgttcaga
cttctccaggaacacaaaggtaagaaagcacgcttagactggaacaccgacgctgcctct
ctgattggagaagaactgcaagtggatttcttggatcatgttccactcacaactcacaac
tttgctcggaaaacgttcctgaagcttgcattctgtgacatctgtcaaaagttcctgcta
aatggatttcggtgtcagacttgtggctacaagtttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacagctcttgctgtttccaaattccact
gttggtgatagcggagtcccagcactaccttctttgacaatgcgtcggatgcgagagtct
gtttcccggatgcctgctagttcccagcacagatactccacacctcatgccttcactttc
aacacctccagcccttcctctgaaggttccctctcccagaggcagaggtcaacgtccact
cccaatgttcacatggtcagcaccaccttgcctgtggacagcaggatgattgaggatgca
attcgaagtcacagtgaatcagcctcaccttcagccctgtccagcagccccaacaacctg
agcccaacaggatggtcgcagcctaaaacccctgtgccagcacaaagagaacgggcacca
ggatctgggacccaggaaaaaaacaaaattaggcctcgtgggcagagagattcaagctat
tactgggaaatagaagccagtgaggtgatgctgtccactcggattggatcgggctccttt
ggcactgtgtacaagggcaagtggcacggagatgttgcagtaaagatcctaaaagtggtt
gacccaaccccagagcagcttcaggccttcaggaacgaggtggctgtcttgcgcaaaaca
cggcatgttaatatcctgctgttcatgggctatatgacaaaggacaacctggccattgtg
acccagtggtgtgaaggcagcagtctctataaacacctacatgtccaggagaccaaattc
cagatgttccagctaattgacattgcccgacagacagctcagggaatggactatttgcat
gcgaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctc
acggtgaaaattggagattttggtttggcaacagtgaagtcacgctggagtggttctcag
caggttgaacagcccaccggctctgtgctatggatggccccagaagtaatccgaatgcag
gataacaacccgtttagcttccagtctgacgtctactcctatggcattgtgctgtatgag
ctgatgacgggggagcttccctactcgcacatcaacaatcgagaccagatcatcttcatg
gtgggccgtggatatgcttccccagatcttagcaggctctacaagaactgccccaaggca
atgaagagattggtggccgactgtgtgaagaaagtaaaggaagagaggcctctgtttccc
cagatcctgtcttccatcgagctgcttcagcactctctgccgaaaatcaacaggagcgcc
tctgagccctctctgcatcgggcggcccacactgaggacatcaatgcttgcactctgacc
acatccccgaggctacctgtcttctag

KEGG   Cricetulus griseus (Chinese hamster): 100771486
Entry
100771486         CDS       T02813                                 

Gene name
Braf
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase B-raf isoform X6
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge01521  EGFR tyrosine kinase inhibitor resistance
cge01522  Endocrine resistance
cge04010  MAPK signaling pathway
cge04012  ErbB signaling pathway
cge04015  Rap1 signaling pathway
cge04024  cAMP signaling pathway
cge04062  Chemokine signaling pathway
cge04068  FoxO signaling pathway
cge04150  mTOR signaling pathway
cge04270  Vascular smooth muscle contraction
cge04510  Focal adhesion
cge04650  Natural killer cell mediated cytotoxicity
cge04720  Long-term potentiation
cge04722  Neurotrophin signaling pathway
cge04726  Serotonergic synapse
cge04730  Long-term depression
cge04810  Regulation of actin cytoskeleton
cge04910  Insulin signaling pathway
cge04914  Progesterone-mediated oocyte maturation
cge04928  Parathyroid hormone synthesis, secretion and action
cge04934  Cushing syndrome
cge05010  Alzheimer disease
cge05022  Pathways of neurodegeneration - multiple diseases
cge05034  Alcoholism
cge05160  Hepatitis C
cge05161  Hepatitis B
cge05200  Pathways in cancer
cge05205  Proteoglycans in cancer
cge05210  Colorectal cancer
cge05211  Renal cell carcinoma
cge05212  Pancreatic cancer
cge05213  Endometrial cancer
cge05214  Glioma
cge05215  Prostate cancer
cge05216  Thyroid cancer
cge05218  Melanoma
cge05219  Bladder cancer
cge05220  Chronic myeloid leukemia
cge05221  Acute myeloid leukemia
cge05223  Non-small cell lung cancer
cge05224  Breast cancer
cge05225  Hepatocellular carcinoma
cge05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cge00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100771486 (Braf)
   04012 ErbB signaling pathway
    100771486 (Braf)
   04015 Rap1 signaling pathway
    100771486 (Braf)
   04068 FoxO signaling pathway
    100771486 (Braf)
   04024 cAMP signaling pathway
    100771486 (Braf)
   04150 mTOR signaling pathway
    100771486 (Braf)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100771486 (Braf)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100771486 (Braf)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100771486 (Braf)
   04062 Chemokine signaling pathway
    100771486 (Braf)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100771486 (Braf)
   04914 Progesterone-mediated oocyte maturation
    100771486 (Braf)
   04928 Parathyroid hormone synthesis, secretion and action
    100771486 (Braf)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100771486 (Braf)
  09156 Nervous system
   04726 Serotonergic synapse
    100771486 (Braf)
   04720 Long-term potentiation
    100771486 (Braf)
   04730 Long-term depression
    100771486 (Braf)
   04722 Neurotrophin signaling pathway
    100771486 (Braf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100771486 (Braf)
   05205 Proteoglycans in cancer
    100771486 (Braf)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100771486 (Braf)
   05212 Pancreatic cancer
    100771486 (Braf)
   05225 Hepatocellular carcinoma
    100771486 (Braf)
   05226 Gastric cancer
    100771486 (Braf)
   05214 Glioma
    100771486 (Braf)
   05216 Thyroid cancer
    100771486 (Braf)
   05221 Acute myeloid leukemia
    100771486 (Braf)
   05220 Chronic myeloid leukemia
    100771486 (Braf)
   05218 Melanoma
    100771486 (Braf)
   05211 Renal cell carcinoma
    100771486 (Braf)
   05219 Bladder cancer
    100771486 (Braf)
   05215 Prostate cancer
    100771486 (Braf)
   05213 Endometrial cancer
    100771486 (Braf)
   05224 Breast cancer
    100771486 (Braf)
   05223 Non-small cell lung cancer
    100771486 (Braf)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100771486 (Braf)
   05022 Pathways of neurodegeneration - multiple diseases
    100771486 (Braf)
  09165 Substance dependence
   05034 Alcoholism
    100771486 (Braf)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100771486 (Braf)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100771486 (Braf)
   05160 Hepatitis C
    100771486 (Braf)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100771486 (Braf)
   01522 Endocrine resistance
    100771486 (Braf)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cge01001]
    100771486 (Braf)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100771486 (Braf)
Protein kinases [BR:cge01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100771486 (Braf)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100771486
NCBI-ProteinID: XP_027247331
LinkDB
Position
1
AA seq 798 aa
MAALSGGGGGSSGGGGGGGSSGGGGGGGSGGGAEQGQALFNGDMEPEAGAGAAASSAADP
AIPEEVWNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLE
SLGNGTDFSVSSSASMDTVTSSSSSSLSVLPSSLSVFQTPTDVSRNNPKSPQKPIVRVFL
PNKQRTVVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEE
LHVEVLENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCV
NYDQLDLLFVSKFFEHHPVTQEEASLAETALTSGSPSAPPSDSIGPQILTTPSPSKSIPI
PQPFRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDEKFPEVELQDQRDLIRDQGFRG
DGGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDD
WEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTR
HVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHA
KSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQD
KNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAM
KRLMAECLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACA
SPKTPIQAGGYGEFAAFK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atggcggcgctgagtggcggcggcggtggcagcagcggtggcggcggcggcggcggcagc
agcggcggcggcggtggcggcggcagcggcggcggcgccgagcagggccaggctctgttc
aatggggacatggagcccgaggccggcgctggcgccgcggcctcctcggctgcggacccg
gccatccctgaagaggtgtggaatatcaagcaaatgattaaattgacacaggaacatata
gaggccctattggacaaatttggtggggagcataatccaccatcaatatacttggaggcc
tatgaagagtacaccagcaagctagatgccctccagcaaagagagcaacagctgttggag
tccctggggaatggaactgatttttctgtgtctagctcggcatcaatggataccgttaca
tcctcctcctcttctagcctttcagtgctaccttcctctctctcagtttttcaaactccc
acagacgtatcacgcaacaaccccaagtcaccacagaaacccatcgttagagtcttcctg
cccaacaaacagaggacagtggtacccgcaagatgtggtgttacagtccgagacagtcta
aagaaagcactgatgatgagaggtctgatcccagaatgctgcgctgtttacagaattcaa
gatggagagaagaaacccattggctgggacactgatatttcctggcttactggagaagag
ttgcatgtagaagtgctggagaatgtcccacttacaacacacaactttgtacggaaaact
tttttcacgttagcgttctgtgacttttgtcgaaagctgcttttccagggtttccgctgt
cagacttgtggctataagttccaccagcgctgtagcacggaggtcccactgatgtgtgtc
aattatgaccaactggatttgctgtttgtctccaagttctttgagcatcacccagtaaca
caggaggaggcttccttagcagagactgcccttacatcgggatctccttctgcacccccc
tcagactctattgggccccaaatcctcaccactccatctccttcaaaatccattccaatt
ccacagcccttccgaccagcagatgaggatcatcgaaatcagtttgggcagcgagaccgg
tcctcctcagctcccaatgttcatataaacacaatcgaacctgtcaatatcgatgaaaaa
ttcccagaagtggaattacaggatcaaagggatttgattagagaccaggggtttcgtggt
gatggaggagggtcaactacaggtttgtctgccaccccacctgcctctttacctggctcg
ctcactaatgtgaaagccttacagaaatctccaggacctcagcgggaaaggaagtcatca
tcatcctcagaagacagaaatcggatgaaaacacttggtagacgagattcaagtgatgat
tgggagattcctgatggacagattacagtgggacaaagaattggatctggatcatttgga
actgtctacaagggaaagtggcatggtgacgtggcagtcaagatgctgaacgtgacagca
cccacacctcagcagttacaggccttcaaaaatgaagtcggagtgctcaggaaaacgcgg
catgtgaatatcctacttttcatgggctattcaacaaagccacagctggcgattgtgacc
cagtggtgtgagggctccagcctgtatcaccatctccacatcattgagaccaaatttgag
atgatcaaacttatagatattgcacggcagaccgcacagggcatggattacttacacgcc
aagtcaatcatccacagagacctcaagagtaataatatatttcttcatgaagacctcacg
gtaaaaataggtgattttggtctagccacagtgaaatctcgatggagtgggtcccatcag
tttgaacagttgtctggatctattttgtggatggcaccagaagtaatcagaatgcaagat
aaaaacccatacagctttcagtcagatgtatatgcatttgggattgttctgtacgaacta
atgactggccagctaccttactcgaacatcaacaacagggatcagataatttttatggtg
ggacgaggatatctatctccagatctcagtaaggtacggagtaactgtccgaaagccatg
aagagattaatggcagagtgcctcaaaaagaaaagagatgagagaccactctttccccaa
attctcgcctctattgagctgctggcccgctcattgccaaaaattcaccgcagtgcatca
gaaccctccttgaatcgggctggttttcaaacggaagattttagtctgtatgcttgtgct
tctcctaaaacacccatccaagcagggggatatggagaatttgcagccttcaagtag

DBGET integrated database retrieval system