KEGG   Cricetulus griseus (Chinese hamster): 100751501Help
Entry
100751501         CDS       T02813                                 

Gene name
Pfkp
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00030  Pentose phosphate pathway
cge00051  Fructose and mannose metabolism
cge00052  Galactose metabolism
cge01100  Metabolic pathways
cge01200  Carbon metabolism
cge01230  Biosynthesis of amino acids
cge03018  RNA degradation
cge04066  HIF-1 signaling pathway
cge04152  AMPK signaling pathway
cge04922  Glucagon signaling pathway
cge05230  Central carbon metabolism in cancer
Module
cge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100751501 (Pfkp)
   00030 Pentose phosphate pathway
    100751501 (Pfkp)
   00051 Fructose and mannose metabolism
    100751501 (Pfkp)
   00052 Galactose metabolism
    100751501 (Pfkp)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100751501 (Pfkp)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100751501 (Pfkp)
   04152 AMPK signaling pathway
    100751501 (Pfkp)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100751501 (Pfkp)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100751501 (Pfkp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100751501 (Pfkp)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cge03019]
    100751501 (Pfkp)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100751501 (Pfkp)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100751501 (Pfkp)
Messenger RNA biogenesis [BR:cge03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100751501 (Pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DUF4893
Motif
Other DBs
NCBI-GeneID: 100751501
NCBI-ProteinID: XP_027260883
UniProt: G3GR86
LinkDB All DBs
Position
3
AA seq 793 aa AA seqDB search
MGSDDSSGSSVCLPKYLEHLSGDGKAIGVLTSGGDAQGMNAAVRAVVRTGIYVGAKVYFV
YEGYQGLMEGGSNIVEAKWENVSSILQIGGTIIGSARCNAFRSREGRLKAAYNLVRLGIT
NLCVIGGDGSLTGANIFRKEWNGLLEELAQNGQIEKDEVHKHSYLNVVGMVGSIDNDFCG
TDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLP
ESPPEDGWEESMCLKLSENRAHKKRLNIIIVAEGAIDSQNQPISSEKIKELVVNQLGFDT
RVTILGHVQRGGTPSAFDRILASRMGVEAVIALLEGDPETPACVVSLRGNQAVRLPLVEC
VQMTQAVQKAMDERNFHEAVRLRGRSFEGNLKTYKRLAIKQHDDKITKSNCNVAIINVGA
PAAGMNAAVRSAVRVGIADGHKMFAIYDGFDGFAKGQIKEFSWEDVGGWTGQGGSILGTK
RTLPGKHLEKIAEQIRSHSINALLIVGGFEAYLGLLELAAAREKHEAFCIPMVMVPATVS
NNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMSGLAAGA
DAAYIFEEPFDIRDLQSNVGHLREKMKTTIQRGLILRNESCSVNYTTDFICQLYSEEGKG
VFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMEWITEKLKGSQGTGKKFVDDDSICVL
GISKRDLLFQPVEQLKKEADFEHRIPKKQWWLKLRPLMKILAKYKTSYDVSDSGKLEPLH
PNQGTSDGEPAAI
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgggctccgatgactcctcgggctccagtgtctgcttaccgaagtacttggagcacctc
tctggggatggcaaagccatcggtgtcctgaccagcggcggggatgcccaaggtatgaac
gctgctgtccgtgctgtggtgcgcacgggaatatacgtgggggccaaagtatactttgta
tatgagggttaccaaggcctgatggaaggaggctccaatattgtggaagccaaatgggag
aatgtctccagcattctgcaaataggtggaacgataatcgggagtgcccgttgcaatgcc
ttccgcagccgggaagggcgtctgaaagctgcctataacttggtgcgtttgggcatcacc
aacttgtgtgtgatcggcggggacggaagtctcacgggagccaacatcttccggaaggag
tggaacggacttcttgaagaactggctcagaatggccagatcgaaaaagacgaagtccat
aagcattcctacctcaacgtggtaggcatggtgggctccattgacaatgacttctgtggc
acagacatgaccattgggactgattcggctctgcaccggattattgaagttgttgatgcc
atcatgaccactgcccagagccaccagaggaccttcgtcctggaggtgatggggagacat
tgtggttacttggccttggtgagtgccttggcttgcggtgctgactgggtgttccttccg
gagtctccacccgaggatggttgggaggaaagcatgtgcttgaaactctcagagaaccgt
gcccacaaaaagaggctgaacattatcattgtggctgaaggagcaatcgatagccaaaat
caaccaatcagctctgagaaaatcaaggagcttgtggtgaatcagctgggctttgacacc
cgggtgaccattcttgggcatgtgcaacgaggagggaccccttctgcatttgacaggatt
ttggccagccgcatgggggtggaagctgtcattgccttgctggagggtgatcctgaaacc
ccggcctgtgtggtgtcgctgagaggaaaccaggctgtgcgcctgcctctggtggaatgt
gtgcaaatgacccaggctgtacaaaaggcaatggatgagaggaactttcatgaagccgta
agactccgagggaggagttttgagggaaacctgaaaacctacaaacgtcttgccataaag
cagcatgatgacaagatcaccaagagcaattgcaatgttgctatcatcaatgtgggggca
cctgcagctggaatgaatgcagctgtgcgctctgctgttcgagtcgggattgcagatggt
cacaagatgtttgccatctatgatggattcgatggcttcgccaaaggccaaataaaagaa
ttctcctgggaagatgtcggaggttggactggacaaggagggtccattcttgggacgaaa
cgcaccctacctggaaaacatttggagaagatcgccgaacagattcgttcccacagtatc
aatgcgcttctgatcgttggtggatttgaggcctacctgggactcctagagctggcagct
gcccgggagaaacacgaggcgttctgtatccctatggttatggttcctgctactgtctcc
aacaatgtgccgggttccgatttcagcatcggggcagacacggctctgaacactatcaca
gacacgtgtgaccgaatcaaacagtcagccagtgggaccaagcgccgggtgttcatcatt
gaaacgatgggtggatactgtggctacctggccaacatgagtggacttgctgcaggagca
gatgctgcctacatctttgaagaaccatttgatatcagagatttacagtccaacgtgggt
cacttgagagaaaaaatgaagaccactatccagaggggccttatactcagaaatgaaagc
tgcagtgtaaactacaccactgacttcatttgccagctctactcagaggaaggcaaagga
gtgtttgactgcaggaaaaacgtgctgggccacatgcagcaggggggagcaccttctcca
ttcgatagaaactttgggacaaaaatctctgctagagctatggagtggatcacggagaaa
ctgaaggggtcccagggcacagggaaaaagtttgttgacgatgattccatttgtgttctg
ggaataagcaaaagagacctcctgtttcaaccagtggaacaactgaagaaagaagctgat
tttgagcaccggatccccaagaagcagtggtggctgaaactgcggcctctcatgaagatc
ttggccaagtacaagacgagctatgatgtgtctgattcaggcaagctggagcccttgcat
cccaatcagggcacctccgatggagaaccggcagccatctga

KEGG   Cricetulus griseus (Chinese hamster): 100754270Help
Entry
100754270         CDS       T02813                                 

Gene name
Pfkm
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00030  Pentose phosphate pathway
cge00051  Fructose and mannose metabolism
cge00052  Galactose metabolism
cge01100  Metabolic pathways
cge01200  Carbon metabolism
cge01230  Biosynthesis of amino acids
cge03018  RNA degradation
cge04066  HIF-1 signaling pathway
cge04152  AMPK signaling pathway
cge04922  Glucagon signaling pathway
cge05230  Central carbon metabolism in cancer
Module
cge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100754270 (Pfkm)
   00030 Pentose phosphate pathway
    100754270 (Pfkm)
   00051 Fructose and mannose metabolism
    100754270 (Pfkm)
   00052 Galactose metabolism
    100754270 (Pfkm)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100754270 (Pfkm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100754270 (Pfkm)
   04152 AMPK signaling pathway
    100754270 (Pfkm)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100754270 (Pfkm)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100754270 (Pfkm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100754270 (Pfkm)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cge03019]
    100754270 (Pfkm)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100754270 (Pfkm)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100754270 (Pfkm)
Messenger RNA biogenesis [BR:cge03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100754270 (Pfkm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 100754270
NCBI-ProteinID: XP_027252233
UniProt: G3IDJ8
LinkDB All DBs
Position
2
AA seq 851 aa AA seqDB search
MSKNNIRVKFFMCVIKARRVVRNAQNTAEEASTSNMIIPKLQSKTDFLKRLGIVDDPTVV
GLIPMTDTEWIMTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVIRVGIFTGARVF
FVHEGYQGLVDGGEHIREATWESVSMILQLGGTVIGSARCKDFREREGRLRAAHNLVKLG
ITNLCVIGGDGSLTGADTFRSEWSDLLNDLQKAGKITAEEATKSSYLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIVEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLTETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGY
DTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLM
ECVQVTKDVTKAMDEKRFDEAMKLRGRSFMNNWEVYKLLAHVRPPVSKGGLHTVAVMNVG
APAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGT
KRTLPKKNLEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATV
SNNVPGSDFSIGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAG
ADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGK
GIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGC
VLGMRKRTLVFQPVTELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEH
ISRKRSGEAAV
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaacaacattcgtgtgaaatttttcatgtgtgtgattaaggctcgacgagta
gtcaggaatgctcagaacacagctgaggaagcttcaacttccaacatgatcataccaaag
ctacaatcaaagacagatttcttgaagagactaggcattgtggatgatccaaccgtcgtg
ggactcatacccatgactgacactgagtggatcatgacccatgaagagcatcatgcagct
aaaaccctggggatcggcaaggccatcgccgtgctaacctctggtggagatgcccagggt
atgaatgctgctgtcagggcagtgattcgagttggtatctttactggggcccgtgtcttc
tttgtccatgagggttaccaaggcctggtggatggtggcgagcacatcagggaggccacc
tgggagagcgtttccatgatacttcagctgggaggcacagtgattggaagtgcccgatgc
aaagactttcgggagcgagaaggaagactccgggctgcccacaacctggtgaagctggga
atcaccaatctgtgtgtcattggaggtgatggcagcctcactggggctgacactttccgt
tcagagtggagtgacttgttgaatgacctccagaaagctgggaagatcacggctgaagag
gctacaaagtctagctacctgaacattgtgggtctggttggctcaatcgacaatgacttc
tgtggcactgatatgaccattggtactgactctgccctacaccggatagtggagatcgta
gacgccatcaccaccactgctcagagccaccagaggacttttgtgttagaagtgatgggc
cgtcactgtggatacctggccctcgtcacctctctgtcctgtggggccgattgggttttt
attcctgaatgtccaccagatgatgactgggaggaacacctttgtcgtcggctcactgag
acaaggacccgtggttctcgtctcaacatcatcattgttgctgagggtgcaatcgacaag
aatggaaaaccaatcacctcagaagacatcaagaatctggttgtaaagcgtcttggatat
gacaccagggtcactgttttgggacatgtgcagcgtggtgggacaccatcagcctttgat
cggattctgggcagcaggatgggtgtagaagcagtgatggcacttttggaggggacccca
gacaccccagcgtgtgtggtgagcctctctggtaaccaggcagtgcgcctgcccctcatg
gagtgtgtccaagtgaccaaagatgtgaccaaggctatggatgagaagagattcgatgaa
gccatgaagctgagaggccggagcttcatgaacaactgggaggtgtacaagcttctagct
catgtcagacccccagtctctaagggtgggttgcacacagtggctgtgatgaatgtgggg
gccccagctgcaggcatgaacgctgcggtccgctctactgtgaggattggccttatccag
ggcaaccgagtgctggttgtacatgatggctttgagggtctggccaaaggtcagattgaa
gaagctggctggagctatgttggtggctggacaggtcaaggtggttccaaacttggtact
aaaaggactctgcccaagaagaacttggaacagatcagtgccaatataactaagtttaac
attcagggtcttgtcatcattgggggctttgaggcttacacagggggcttggagctgatg
gagggcaggaaacaatttgatgagctctgcatcccatttgtggtcattcctgccacggtt
tccaataacgtccctggatcagacttcagcattggggctgacacagcactaaacaccatc
tgcacgacttgtgaccggattaagcagtctgcggcgggcaccaagcgtcgggtatttatc
atcgagaccatgggtggctactgtggctatctggccaccatggcaggactagcagctggg
gctgatgctgcctacatttttgaggagcccttcaccattcgagatctacaggcaaatgtc
gaacatctggtgcaaaagatgaaaacaactgtgaagagaggcttggtgttaaggaatgag
aagtgcaatgagaactacaccactgacttcattttcaacctgtactctgaggagggaaaa
ggcatcttcgacagcaggaaaaacgtgcttggccacatgcaacagggtggaagtccgact
ccatttgataggaattttgccactaagatgggtgctaaggctatgaactggatgtctggg
aaaatcaaagagagctaccgtaatggacggatctttgccaatactccagactcaggttgt
gttctggggatgcgtaagaggaccctggtctttcagccagtgaccgagctgaaggaccag
acagattttgagcaccggatccccaaagaacagtggtggctgaagctgaggccaatcctc
aaaatccttgccaagtatgagattgatctggacacttctgaccacgcccatctggagcac
atttctagaaagcggtctggagaagctgccgtctag

KEGG   Cricetulus griseus (Chinese hamster): 100762127Help
Entry
100762127         CDS       T02813                                 

Gene name
Pfkl
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, liver type isoform X2
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cge  Cricetulus griseus (Chinese hamster)
Pathway
cge00010  Glycolysis / Gluconeogenesis
cge00030  Pentose phosphate pathway
cge00051  Fructose and mannose metabolism
cge00052  Galactose metabolism
cge01100  Metabolic pathways
cge01200  Carbon metabolism
cge01230  Biosynthesis of amino acids
cge03018  RNA degradation
cge04066  HIF-1 signaling pathway
cge04152  AMPK signaling pathway
cge04922  Glucagon signaling pathway
cge05230  Central carbon metabolism in cancer
Module
cge_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100762127 (Pfkl)
   00030 Pentose phosphate pathway
    100762127 (Pfkl)
   00051 Fructose and mannose metabolism
    100762127 (Pfkl)
   00052 Galactose metabolism
    100762127 (Pfkl)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100762127 (Pfkl)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100762127 (Pfkl)
   04152 AMPK signaling pathway
    100762127 (Pfkl)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100762127 (Pfkl)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    100762127 (Pfkl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cge01009]
    100762127 (Pfkl)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cge03019]
    100762127 (Pfkl)
Enzymes [BR:cge01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100762127 (Pfkl)
Protein phosphatases and associated proteins [BR:cge01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100762127 (Pfkl)
Messenger RNA biogenesis [BR:cge03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100762127 (Pfkl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100762127
NCBI-ProteinID: XP_027250137
LinkDB All DBs
Position
1
AA seq 780 aa AA seqDB search
MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKPANWLSVSNIIQLGGTIIGSARCKAFTTREGRLAAAYNLLQHGITNLCVIGGDG
SLTGANVFRSEWGSLLEELVKEGKISESTAQKHAHLSIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPISSNYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKEVQK
AMDEKRFDEAIQLRGRSFENNWKIYKLLAHQKVSKEKSNFSLAILNVGAPAAGMNAAVRS
AVRTGISEGHTVYVVHDGFEGLAKGQVQEVSWHDVAGWLGRGGSMLGTKRTLPKLHLEAI
VENLRTYNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGRGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAMLWMSEKLRDVYRKGRVFANAPDSACVIGLRKKVVAFS
PVTELKKDTDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIDKGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgtggacctggagaagttgcggatgtcgggggctggcaaggccatcggagtg
ctgaccagcggtggcgatgcgcaaggtatgaatgctgctgtcagggctgtgactcgtatg
ggcatatacgtgggggccaaagtcttcctcatctacgagggctacgagggccttgtggaa
ggaggtgagaacatcaagccagccaactggctcagtgtttccaacatcatccagctgggc
ggcaccattattggcagtgcccgctgcaaggccttcactacgagagaaggacgcctggca
gcagcctacaatctactccaacacggcattaccaacctgtgtgtcattggtggggacggc
agcctcacgggtgccaatgtcttccgtagcgagtggggcagcctcctggaggagctggtg
aaggaaggtaagatctcggagagcacggctcagaagcatgcacacctgagcattgctgga
ctggtgggctccatcgataatgacttctgtggcaccgacatgaccatcggcacagactcg
gccctgcatcgtataatggaggtcatcgatgccatcaccaccactgcccagagccaccag
aggaccttcgtgctggaggtgatggggcgtcactgcggatacctggccctggtgtctgcg
ctggcctcaggggctgactggctgttcatccctgaagcaccccctgaggatggctgggag
aacttcatgtgtgagaggctgggtgagacgcggagccgcggatctcgattaaacatcatt
atcatcgcagagggtgccatcgaccggcatggaaagcccatctcgtctaactacgtgaag
gacctggtggttcagaggctgggctttgacacaagagtgaccgtgctgggccacgtgcag
cgaggagggacgccctcagcctttgaccgagtcctgagcagcaagatgggcatggaggct
gtgatggcattgctggaggccacacccgacacaccagcctgtgtggtcagcctctccggg
aaccagtcagtgcggctgcctctcatggagtgtgtgcaagtgacaaaggaagtgcagaag
gccatggatgagaagaggttcgatgaggccatccagctccgtggcaggagcttcgagaac
aactggaaaatttacaagctccttgcccaccagaaggtctctaaggagaagtccaatttc
tccctggccattctgaatgtgggagcccccgctgctggcatgaacgcagctgtacgctca
gcagtgcgcactggcatctccgagggacacacggtgtacgttgtgcatgatggttttgaa
ggcctggccaagggtcaggttcaagaagtgagctggcatgatgtggcaggctggctgggg
cgcggtggctcaatgctggggaccaagaggacgctgcccaagctccacttggaggccatt
gtggagaacctccgcacctacaacattcacgccctgctggtgattggcggctttgaggcc
tacgagggtgtgctgcagctggtggaggcacgggggcggtatgaggaactctgcattgtc
atgtgtgtcattccggccaccatcagcaacaatgtgcctggcactgacttcagcctgggc
tcagacacagctgtcaacgctgcaatggagagttgtgaccgcatcaagcagtcagcgtcg
gggacgaagcgtcgtgtgttcattgtagagaccatggggggctactgcggctacctagcc
actgtgacaggcattgcggtgggggctgacgccgcctacgtctttgaggatcctttcaac
atccatgacttaaaggctaatgtggagcatatgacggagaagatgaagacagacatccag
aggggcctggtgctccggaacgagaaatgccacgaacactacactacagagttcttgtac
aacctgtattcctcggaaggccggggtgtgttcgactgtaggaccaatgtgctgggccac
ctgcagcagggtggtgctccaactccctttgaccggaactatgggaccaaactgggggtg
aaggccatgctgtggatgtcagagaagcttcgcgatgtctatcgcaaagggcgggtgttc
gccaatgctcccgactcagcctgtgtgattggcctgcggaagaaggtggtggccttcagt
cccgtcacagaactcaagaaagatactgattttgagcatcgcatgccccgggaacagtgg
tggctgaacctgcggctgatgctgaaaatgctggcacactaccgaatcagcatggcagac
tatgtgtctggggagctggagcacgtcacacgacgcaccttgagcatagacaaaggtttc
taa

DBGET integrated database retrieval system